KEGG   Bacillus sp. LM 4-2: BsLM_3777Help
Entry
BsLM_3777         CDS       T03908                                 

Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
balm  Bacillus sp. LM 4-2
Pathway
balm00270  Cysteine and methionine metabolism
balm00330  Arginine and proline metabolism
balm00410  beta-Alanine metabolism
balm00480  Glutathione metabolism
balm01100  Metabolic pathways
Module
balm_M00034  Methionine salvage pathway
balm_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:balm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BsLM_3777
   00330 Arginine and proline metabolism
    BsLM_3777
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BsLM_3777
   00480 Glutathione metabolism
    BsLM_3777
Enzymes [BR:balm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     BsLM_3777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_12 NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AKE25574
LinkDB All DBs
Position
complement(3702235..3703065)
Genome map
AA seq 276 aa AA seqDB search
MSELWYTEKQTKNFGITMKVNKTLHTEQTEFQHLEMVETEEFGNMLFLDGMVMTSEKDEF
VYHEMVAHVPLFTHPNPEHVLVVGGGDGGVIREILKHPSVKKATLVDIDGKVIEYSKKFL
PSIAGKLDDPRVDVQVDDGFMHIAKSENQYDVIMVDSTEPVGPAVNLFTKGFYAGIAKAL
KEDGIFVAQTDNPWFTPELITNVQRDVKEIFPITKLYTANIPTYPSGLWTFTIGSKKYDP
LAVEDSRFFDIETKYYTKDIHKAAFVLPKFVSDLIK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgaactttggtacacagagaagcagacgaaaaactttggcattacgatgaaggtt
aacaaaacgttacatacagaacaaacggagtttcagcatttagaaatggtggaaacagaa
gagttcggcaacatgctgtttttggacggcatggtgatgacatctgaaaaagacgaattc
gtttatcacgaaatggtggcgcatgtgccattatttacgcacccaaatccggagcacgtt
ctcgtagtcggcggcggtgacggcggcgttatcagagaaatcctgaagcacccaagcgtg
aaaaaagcgacacttgtagatattgacggcaaggttatcgaatactctaaaaagttcctt
ccttctatcgcaggcaaactggatgatccgcgcgttgacgtgcaggtagatgacggattt
atgcacattgcaaaatctgaaaatcaatatgacgtcatcatggtagattcgactgaacca
gtcggaccggctgtaaacctgtttacaaaaggattctacgcaggaatcgctaaagcgctg
aaagaagacggcatttttgtcgcacagacggacaacccatggtttacaccggaattaatc
acaaatgtacagcgcgacgtgaaggaaatcttcccgattacgaagctgtatacggcgaac
attccgacatatccaagcggtttgtggacatttacaattggctcgaaaaaatatgatccg
cttgcagtggaagacagccgtttcttcgatattgagacgaaatattacacaaaagatatt
cataaagcggcgtttgttctgccgaaatttgtgagtgacctgattaaataa

DBGET integrated database retrieval system