KEGG   Bacillus sp. LM 4-2: BsLM_4055Help
Entry
BsLM_4055         CDS       T03908                                 

Definition
(GenBank) alkyl hydroperoxide reductase (large subunit) and NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
balm  Bacillus sp. LM 4-2
Brite
KEGG Orthology (KO) [BR:balm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BsLM_4055
Enzymes [BR:balm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BsLM_4055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like Thi4 DAO AlaDh_PNT_C FAD_oxidored NAD_binding_7 FAD_binding_3 NAD_binding_8 Glutaredoxin K_oxygenase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AKE25852
LinkDB All DBs
Position
3974736..3976265
Genome map
AA seq 509 aa AA seqDB search
MVLDANIKAQLNQYMQLIENDIVLKVSAGEDDTSKDMLALVDELASMSSKISVEKAELNR
TPSFSVNRVGEDTGVTFAGIPLGHEFTSLVLALLQVSGRPPKVDQKVIDQVKKISGEYHF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAYKAEVESKNIMAVPTVYLNGESF
GSGRMTLEEILAKMGSGADASEFADKEPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER
FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKEYDIDVMNLQRAKRLEKKDLFELELE
NGAVLKSKTVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVVKNAQTKEITGDQSVNGITY
VDRETGEEKHVELQGVFVQIGLVPNTEWLEGTVERNRMGEIIVDKHGATSVPGLFAAGDC
TDSAYNQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgatgcaaacatcaaagcacaattaaatcaatatatgcagctaattgagaat
gacattgttctcaaagttagcgcaggcgaagatgacacttctaaggacatgctggctctc
gttgatgagctggcttccatgtcatcgaaaatttcagttgaaaaagctgaattaaacaga
acgccaagcttcagtgtcaatcgtgtcggagaagacactggcgtgactttcgccggtatc
cctctgggccacgaattcacatcattagtgttggcgctgctccaagtgagcggcagaccg
cctaaggtggaccaaaaagtcattgatcaggtgaagaagatcagcggtgaataccacttc
gaatcttatatcagcctgacatgccacaactgtcctgatgttgtacaagctttaaacatg
atgagcgtgctgaacccgaacattacgcacacgatgattgacggtgcagcatacaaagca
gaagttgaaagcaaaaacatcatggcagtgccgaccgtttacctgaatggcgaatccttc
ggaagcggccgtatgacgcttgaagaaatccttgcgaaaatgggcagcggcgcagatgca
tctgagtttgctgacaaagagccgtttgacgttcttgttgtcggaggcggacctgctggt
gcaagtgcagcgatctacactgcacgtaaaggcatccgcactggggttgtcgctgaacgc
ttcggcggacaggttctcgacaccatgagcatcgaaaacttcatcagcgtcaaagcgacg
gaaggaccgaagcttgcggcaagtcttgaagagcatgtgaaggaatatgatattgatgtc
atgaaccttcagcgtgcgaaacgccttgagaagaaagatctgttcgaacttgaactcgaa
aacggcgctgttctgaaaagtaaaacagtgatcctttcaacaggtgcacgctggcgcaat
gtcaacgtaccaggtgaacaagagttcaaaaacaaaggtgtcgcatactgcccgcactgt
gatgggccattgtttgaaggcaaagacgtagcggtaatcggcggcggaaactctggtatt
gaagcagcgattgaccttgcaggtattgtcaatcatgttactgtgctagagttcgcaccg
gaactgaaagcagacgaagtcctgcaaaaacgtctctacagcctgcctaacgttactgtc
gtgaaaaacgcacaaacaaaagaaatcacaggcgatcagagcgttaacggcatcacatac
gtagaccgcgaaacaggcgaagaaaaacacgttgaacttcaaggtgtattcgtccaaatc
ggtctcgtgccaaacacagaatggttagaaggaacggttgaacgcaaccgcatgggcgaa
attattgtcgacaaacacggcgcaacaagcgtaccaggcttatttgctgccggcgactgc
acagacagtgcgtacaaccaaattattatttctatgggatcaggtgcaactgccgccctc
ggcgcgtttgattacctaatccgtaactaa

DBGET integrated database retrieval system