KEGG   Bacillus sp. LM 4-2: BsLM_4118Help
Entry
BsLM_4118         CDS       T03908                                 

Definition
(GenBank) putative permease
  KO
K08224  MFS transporter, YNFM family, putative membrane transport protein
Organism
balm  Bacillus sp. LM 4-2
Brite
KEGG Orthology (KO) [BR:balm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:balm02000]
    BsLM_4118
Transporters [BR:balm02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Acriflavin-sensitivity (YnfM) family [TC:2.A.1.36]
    BsLM_4118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr TRI12
Motif
Other DBs
NCBI-ProteinID: AKE25915
LinkDB All DBs
Position
complement(4034320..4035534)
Genome map
AA seq 404 aa AA seqDB search
MTYIQKGTPVFRKITFAFFAAGFNTFAILYCVQPLMEEFTREFHVTPTAASLSLSVTTML
LAVSMLVFGSLSEVWGRKPIMGISMLAASVLCLASAFSPSFHTLLVLRTVQGVALAGLPS
IAMAYLGEEIEPGSLGSAMGLYISGNAIGAVFGRIVSGLLSEYLNWHMAMGAIGVISLIA
SIIFFINLPPSRHFTPRKLKLGKLGMSLIGHLRDRKLFSLFLIGFLLLGSNVALFNYIVY
VLLGPPYSLNKAFASWIFIVMIVGIFSSSFIGRMVDRYGYPKILVMNIFIVIAGALFTIN
SMLAVKILGIALFTFGFFGGHSVASSWVGRRALHNKAQASSLYLFFYYAGSSVCGTVGGL
FWSAFHWLGVVGMITFMLLVALWLSGYLARSAKVPDKRNEKGLN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacatacattcaaaaaggcacaccggtttttcgaaaaattacgtttgctttcttcgct
gcgggtttcaatacatttgcgattctatattgcgtacagccgctcatggaggaattcacg
cgggaatttcatgtaacgcctactgcggcgagtctttctttatctgttaccacaatgctg
ttagctgtgagcatgcttgtctttggttcattatccgaggtgtgggggcgcaagccgatt
atgggtatttccatgctggccgcatcggttctctgtctggcatcggccttcagtccgagc
tttcatacactgctcgtattgagaactgttcaaggcgttgcgctcgcaggccttccgtcg
attgcgatggcttatcttggggaagaaattgaacccggaagtcttggatcagcgatgggg
ctatatatcagcggaaatgcaatcggcgccgttttcggaaggatcgtttccgggctcctg
agcgagtacttgaattggcatatggcgatgggggcaattggtgtcattagtttgattgct
agtattatattttttataaatttgccgccatccaggcattttacgccaagaaaattgaag
ctcgggaaattgggaatgtctctgatcggccacttgagggaccgtaaactattcagcttg
tttctcattggttttttgctgctcggaagcaatgttgcattgtttaattacattgtgtat
gtgctgttgggcccgccgtattcgcttaataaagcatttgccagctggatatttattgtg
atgattgtaggcattttcagctcgtctttcattggaagaatggttgatcgatatggctat
ccaaaaatactggtgatgaatattttcatcgtcattgcaggtgctttattcacgataaac
agtatgctggcagtgaaaattctggggattgccctctttacattcggttttttcggcgga
cattcagttgccagcagctgggtgggcaggagagcccttcataacaaagcacaggcttca
tcgctgtatttgttcttttattacgccggttcaagtgtttgcggaacagtcggagggcta
ttctggtctgcttttcactggctgggcgtcgtcggtatgatcaccttcatgctgctggtt
gcgttatggctgtcgggatacttggcaagaagtgcgaaagtgccggataaaaggaacgaa
aaaggattgaattga

DBGET integrated database retrieval system