KEGG   Bacillus sp. LM 4-2: BsLM_4129Help
Entry
BsLM_4129         CDS       T03908                                 

Definition
(GenBank) hypothetical protein
  KO
K08168  MFS transporter, DHA2 family, metal-tetracycline-proton antiporter
Organism
balm  Bacillus sp. LM 4-2
Brite
KEGG Orthology (KO) [BR:balm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:balm02000]
    BsLM_4129
   01504 Antimicrobial resistance genes [BR:balm01504]
    BsLM_4129
Transporters [BR:balm02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    BsLM_4129
Antimicrobial resistance genes [BR:balm01504]
 Gene variants
  Tetracycline resistance genes
   Transporters
    BsLM_4129
 Gene sets
  Vancomycin resistance modules
   Tetracycline resistance, efflux pump Tet38 [MD:M00704]
    BsLM_4129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: AKE25926
LinkDB All DBs
Position
complement(4042723..4044099)
Genome map
AA seq 458 aa AA seqDB search
MNTSYSQSTLRHNQVLIWLCVLSFFSVLNEMVLNVSLPDIANEFNKLPASANWVNTAFML
TFSIGTALYGKLSDQMGIKNLLLFGIMVNGLGSIIGFVGHSFFPILILARFIQGIGAAAF
PALVMVVVARYIPKENRGKAFGLIGSLVAMGEGVGPAIGGMVAHYIHWSYLLLIPTATII
TVPFLIKLLKKEERIRGHIDMAGIILMSAGILFFMLFTTSYRFSFLIISILAFFIFVKHI
RKAQDPFVDPELGKNVFFVIGTLYGGLIFGTAAGFVSMVPYMMKDVHHLSTAAIGSGIIF
PGTMSVIIFGYIGGLLVDRKGSLYVLTIGSALLSSGFLIAAFFIDAAPWIMTIIVIFVFG
GLSFTKTVISTVVSSSLKEKEAGAGMSLLNFTSFLSEGTGIAIVGGLLSIGFLDHRLLPI
DVDHSTYLYSNMLILFAGTIVICWLVILNVYKRSRRHR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacgtcttattcacaatcaactttacggcacaatcaagttttgatttggctttgt
gttctatcatttttcagcgtattaaatgaaatggttctgaacgtctcattacctgatatt
gccaacgagtttaataaactgccagcaagtgcaaactgggtgaatactgcctttatgtta
accttctccattggaacagctctatatggaaagctatcagaccagatgggcatcaaaaat
ctgcttctatttgggattatggtaaatggcttagggtcgatcattggatttgttggacac
tctttctttcctattctcattctagcccgatttattcaagggattggtgcagccgcattc
ccagctcttgtgatggttgtcgttgcgcgctatattccaaaagagaacagggggaaagca
tttggcctgatcgggtccctggtagcaatgggagaaggtgttgggccagctattggcgga
atggttgctcattatatccattggtcgtatttgctgcttattccaactgcaacaattatc
accgttccattccttataaaattgttgaaaaaggaagagagaataagaggacacattgat
atggcagggattatattgatgtctgcaggtatcttattttttatgctgtttacaacatct
tatagattttcttttctgatcatcagtattcttgctttcttcatatttgtaaaacacatt
aggaaagctcaggacccttttgttgaccctgaattagggaaaaacgtcttttttgtgatt
ggaaccctttacggaggactaatatttggtacagcagcaggatttgtctctatggttcct
tacatgatgaaagatgttcaccatttaagtactgcagcaattggaagcggcattattttc
cccggaacaatgagtgtcatcatcttcggttacattgggggattgcttgttgatcggaaa
ggttccttgtatgtactaactattggaagtgccttgctttcttccggctttttaatcgct
gccttttttatagatgcagcaccatggatcatgacaattatagtaatttttgtttttggg
gggctatctttcacaaaaacagttatatctacagttgtgtctagcagtttgaaagaaaag
gaagcgggcgctggaatgagtttgcttaatttcacgagctttttatcagagggaacgggt
attgcgattgtaggcggtttattatctatcggcttcttagaccataggctgctgcctatt
gacgttgatcactctacctatttgtatagcaatatgctcatactttttgcagggaccatt
gttatttgttggctagtaatcttgaatgtatataaacgttcgcggaggcatcgctaa

DBGET integrated database retrieval system