KEGG   Bacillus altitudinis: CFN77_00440Help
Entry
CFN77_00440       CDS       T05199                                 

Definition
(GenBank) redox-regulated molecular chaperone Hsp33
  KO
K04083  molecular chaperone Hsp33
Organism
balt  Bacillus altitudinis
Brite
KEGG Orthology (KO) [BR:balt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:balt03110]
    CFN77_00440
Chaperones and folding catalysts [BR:balt03110]
 Heat shock proteins
  HSP33
   CFN77_00440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 DUF3222
Motif
Other DBs
NCBI-ProteinID: ATH70759
UniProt: A0A0B0Q8P7
LinkDB All DBs
Position
82296..83171
Genome map
AA seq 291 aa AA seqDB search
MDYLVKALAYDGKVRAYAANTTDTINEAQRRHHTWPTASAAIGRTMTATVMMGAMLKGEN
KLTVKIEGGGPIGAIIADGNAKGQVRGYVSNPQVHFDLNEHGKLDVRRAVGTSGTLSVVK
DIGLKDHFTGQTEIVSGEIGDDFTYYLVSSEQVPSSVGVGVLVNPDNSILAAGGFIIQLL
PGTEDAVIERLEKRLSTIEPISKLIEKGMTPEEILEEVLGEKPQILETVPVEFSCNCSKE
RFANGIISLGKAEIEDMIEQDGQAEAQCHFCNETYVFTKEELEELREEITR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttagttaaagcgttagcatatgacgggaaagtccgtgcgtatgctgcgaac
acaacagatacaatcaacgaagcgcagagaagacaccatacgtggccaactgcttcagct
gcaatcggcagaaccatgacagcgactgtcatgatgggagccatgctgaaaggcgagaat
aaattaactgtcaaaattgaaggcggtgggccgatcggagccatcattgcagatggaaac
gcaaaaggtcaggtgcgcggatatgtctcaaacccacaagttcactttgatttaaatgaa
catgggaagctggacgttagacgtgctgttggaacatctggaacgttaagtgttgtcaaa
gatatcggactgaaagaccactttacagggcaaacggaaattgtctcaggtgaaattgga
gatgactttacttattacctggtctcctctgaacaagtgccatcctcagtaggtgtgggt
gttcttgtcaatccagacaactcgatccttgcagcaggcggtttcatcattcaattgctg
cctggaacagaagatgcagtcatcgaaagactcgaaaagagattatcaaccattgaaccg
atctctaaactgattgaaaaagggatgactcctgaagaaattttagaagaagtgctcggt
gaaaaacctcaaatcttagaaactgtacctgtcgaattttcttgtaactgctcaaaagaa
cggtttgccaacggtattatcagcctagggaaagccgaaattgaggatatgattgaacaa
gacggacaagcagaagctcaatgccatttttgtaacgaaacgtatgtatttacaaaagaa
gagctagaagagctacgtgaagaaataacccgctaa

DBGET integrated database retrieval system