KEGG   Bacillus altitudinis: CFN77_02595Help
Entry
CFN77_02595       CDS       T05199                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
balt  Bacillus altitudinis
Pathway
balt00473  D-Alanine metabolism
balt01100  Metabolic pathways
balt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:balt00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CFN77_02595 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CFN77_02595 (alr)
Enzymes [BR:balt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CFN77_02595 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:balt01011]
 Precursor biosynthesis
  Racemase
   CFN77_02595 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ATH71149
LinkDB All DBs
Position
541756..542937
Genome map
AA seq 393 aa AA seqDB search
MDTNAFYRDTWAEINLSAIKHNVSHMKDHIGQSVQLMAVVKANAYGHGDIEVTRAALKAG
ADLLAVAFLDEAISLRNKGVKAPILVLGAVPAEYVKVAVRYNVIMTAYSIDWLREVVKVM
KGQMGQPIRFHLKIDSGMNRLGVKTIEQVSEVKELVHNHSFLKLEGVFTHFATADEKDEN
YFGMQVDTFKTLLQPLHTDKLLIHCANSAAGLRFKDTLFNMVRFGISMYGLSPSEEIKDE
LPFQLEEALSLHTKLAHVKPIQKGESVSYGATYTANQDTWIGTIPIGYADGWIRKLAGTE
VLVGGKRRKIAGRVCMDQFMVDLQKDIPAGEPVVLIGTQGEDRISVDEIAKRLETINYEV
TCSVGYRVPRVYIEDGERVHVRNPLLQGGPSFL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaacgccttttatagagacacatgggcagaaattaatttatcagctatcaag
cataatgtttcacatatgaaagaccatattggtcaaagcgtccaactaatggctgtggtg
aaagccaatgcatatggacatggagatatagaagtgacaagagctgctctcaaagcagga
gcagacctgttagccgtcgcttttttagatgaagccatttctttaagaaataaaggtgta
aaagcacctattcttgtgctcggcgcagtaccggcagagtatgtcaaagtcgccgttaga
tacaacgttatcatgactgcttactcgatcgattggctaagagaagtcgtcaaagtgatg
aaagggcagatgggacaacccattcgtttccacttgaaaatcgacagcggcatgaatcgg
ttaggtgtgaaaacaatcgagcaggtgagcgaagtaaaagagcttgtccacaatcattct
tttttaaagctggaaggagtatttactcactttgccacagcggatgaaaaagatgaaaac
tacttcggtatgcaggttgatacgtttaaaacattgcttcaaccgcttcatacggacaaa
ctgctcattcattgcgccaacagtgcagcaggtctaaggtttaaagacactttatttaat
atggttcgttttggcatcagtatgtacgggctgtcgccgtcggaagaaatcaaagatgaa
ttgccgtttcaactggaagaagcattatctcttcatacaaaacttgcacatgtaaagccc
attcaaaagggtgagagcgtgagctatggtgcaacttatacagcgaatcaagatacatgg
attggtacaattccaattgggtatgcagacggctggatcaggaagcttgccggaacagaa
gtgctcgttggcggaaaacgccgaaagattgccggaagggtgtgtatggatcaattcatg
gttgatttgcaaaaggacattccggcaggggagccagtcgtgctcatcgggacacaaggc
gaagacaggatatctgtcgatgaaatagccaagcggcttgaaaccattaactacgaagtc
acttgttctgttggctaccgcgtcccaagagtctatatagaggacggcgaaagggttcat
gtacgaaatccgttgcttcaaggcggtccaagctttttataa

DBGET integrated database retrieval system