KEGG   Bacillus altitudinis: CFN77_02775Help
Entry
CFN77_02775       CDS       T05199                                 

Definition
(GenBank) MmcQ/YjbR family DNA-binding protein
Organism
balt  Bacillus altitudinis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YjbR
Motif
Other DBs
NCBI-ProteinID: ATH71177
LinkDB All DBs
Position
568223..568600
Genome map
AA seq 125 aa AA seqDB search
MKKETLQAFCLSLQGATHDYQPEWQADRYHIGGKMFAMMGGDVDRKPVITLKCDPQRAEE
LREMHEGIIPGYYMNKTHWNSIYLDADIPSSFVEELIEHSYQLVFHKLTKKAQQAILQHD
SKETD
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagagacactacaggcattttgtctttctttacaaggagcaacccacgactat
caacctgagtggcaggcagatcgttatcatataggtggaaagatgttcgccatgatgggg
ggagacgtcgatcgcaagccagtcatcactttaaaatgtgatccgcaacgcgctgaagaa
ttaagagaaatgcatgaaggaattattcccggctattacatgaataagacgcattggaat
tctatttatcttgatgcagatattccatcttcatttgtcgaagagctaattgaacattcc
tatcaactggtttttcacaaattaacaaaaaaagctcagcaggctatcctccaacatgat
tcaaaagaaaccgattaa

DBGET integrated database retrieval system