KEGG   Bacillus altitudinis: CFN77_04585Help
Entry
CFN77_04585       CDS       T05199                                 

Definition
(GenBank) HlyD family secretion protein
Organism
balt  Bacillus altitudinis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 HlyD_2 Biotin_lipoyl Biotin_lipoyl_2 HlyD QRPTase_N MazE_antitoxin
Motif
Other DBs
NCBI-ProteinID: ATH71488
UniProt: A0A0B0QB24
LinkDB All DBs
Position
909296..909928
Genome map
AA seq 210 aa AA seqDB search
MNRGRLLLTNIIGLIVILAIIAGGAYYYYESTNFVKTDEAKVTGDMYQITAPAAGQIKGW
DINEGDEVQKDSTVAKVEGEAKTNIKAVADGTLVKKEVQNNQQVQPGTVLGETIDLSKLY
ITANIKETDIKNIEKGDKVDIVVDGDPDTTFEGTVEQIGYATNSTFNMLPATNSSGNYTK
VTQKVAVKISIKNPSDKVLPGMNASVKISS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagggcgtttattgctaacgaatattattggccttattgtgattcttgccatt
attgccggaggtgcttattactactacgaaagcacaaacttcgtaaaaacagatgaagca
aaagtgacaggtgacatgtaccaaattacagcgccagcagctggacaaatcaaaggctgg
gacatcaatgaaggtgacgaagtgcaaaaagacagcacagttgcaaaagttgaaggagaa
gcaaaaacaaacattaaagcagtggctgatggcacattagtcaaaaaagaagtacaaaac
aaccaacaagtgcagcctgggacagttcttggtgaaacgattgacctaagcaagctttac
attacagcgaatattaaagaaacagacattaagaacattgaaaaaggtgacaaagtggac
atcgttgtagacggcgatcctgatacaacatttgaaggaactgttgaacaaattggttat
gcaacaaactcaacattcaatatgctgccagcaacaaactcaagtggtaactacacgaaa
gtgacacaaaaagtagcagtgaaaatttcaattaaaaatccatctgacaaagtacttcca
ggtatgaatgcttctgtcaaaatttcttcttaa

DBGET integrated database retrieval system