KEGG   Bacillus altitudinis: CFN77_04725Help
Entry
CFN77_04725       CDS       T05199                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
balt  Bacillus altitudinis
Pathway
balt00564  Glycerophospholipid metabolism
balt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:balt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CFN77_04725
Enzymes [BR:balt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CFN77_04725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_binding_3 GIDA NAD_binding_8 FAD_oxidored 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ATH71515
LinkDB All DBs
Position
938836..940497
Genome map
AA seq 553 aa AA seqDB search
MTFSSLEREQMLQDMTKKPYDVFIIGGGITGAGTALDAASRGMRVGLAEMQDFAAGTSSR
STKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPMHKGGTFGKFSTSI
GLRVYDFLAGVKHSERRSMLSAKETLAKEPLVKKDGLKGGGYYVEYRTDDARLTIEVMKE
AVKFGAEAVNYAKVKEFIYDKGKVVGVVIEDVMTQKTYDVYAKKIVNATGPWVDQLRDKD
HSKEGKHLQHTKGIHLVFDQSVFPLKQAIYFDTPDKRMVFAIPREGKTYVGTTDTVYKKQ
LEHPRMTKADRDYVIKAIQYMFPDLHITEKDVESNWAGLRPLIHEEGKDPSEISRKDEVW
TSSSGLITIAGGKLTGYRKMAEHIVNLVRDGLKEETGKDFGPCKTKHMPISGGHVGGSKN
MASFVQAKTAEGASVGLTEPIAQKLAEKYGSNVSNVFKRVEQLQGEADKRNIPAYVLAEL
VYAIEEELAVTPVDFFLRRTGSLLFNINWAKTYAQPVVDYMADRFGWDEATKQKHQTELD
RLFHEAVVPLDAE
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgactttttctagcttagaaagagaacaaatgcttcaggacatgacaaaaaaaccatat
gatgtgtttatcattggtgggggtattactggcgctggtacagcacttgatgcggcttca
cgcggaatgcgtgtcggtcttgcggaaatgcaggacttcgcagcaggtacgtctagccgc
tcaacgaaacttgtacacggcggacttcgttatttaaaacaatttgaagtgaaaatggtc
gcagaggtcggtaaagagcgtgccatcgtatacgaaaacggtcctcatgtgacaacgcca
gaatggatgcttcttccgatgcataaaggcgggacattcggtaagttttcaacttcaatc
ggacttagagtatatgactttttagctggcgttaagcatagtgaacgtagaagtatgcta
agtgcaaaagagacacttgcaaaagaaccacttgtgaaaaaggatggcttaaaaggtggg
ggctactatgttgaataccgtacagatgatgcacgcctgacaattgaagtcatgaaagag
gctgtgaaattcggggcagaagcggtcaactatgcgaaagtaaaagaatttatttatgat
aaaggcaaagttgtcggtgttgtcattgaagatgtgatgacgcaaaaaacatacgacgta
tatgcgaaaaaaatcgtcaatgcgacaggtccatgggtcgatcagctaagagacaaggac
cactcaaaagaggggaaacatttacaacatacaaaaggaattcacttagtatttgaccaa
tctgttttcccattaaaacaagcaatctactttgacacacctgataaacgaatggtcttt
gcgattccaagagaaggaaaaacgtacgtgggaacaacagataccgtatacaaaaaacag
ctggaacatccgcgtatgacaaaagcagatcgtgattacgtgatcaaagccattcaatat
atgttcccagatcttcatattacagagaaagacgttgaatctaactgggctggtcttcgt
ccactcattcatgaagaaggcaaagatccttcagaaatttctcgtaaggatgaggtatgg
acatcatcttcaggcttaatcacgattgctggcggtaaattaacaggttaccgtaaaatg
gctgaacacattgtgaatcttgtacgtgatggacttaaagaggaaactggaaaagatttc
ggaccatgtaaaacgaaacatatgccaatttcaggcgggcatgtaggcggttcaaaaaat
atggcatcctttgttcaagcgaaaacggcagaaggagcatccgttggtttgacagaaccg
attgcacaaaaattagctgagaaatatggctcaaacgtcagcaatgtcttcaagcgtgtg
gagcagcttcaaggggaagcagacaaacgaaatattcccgcatatgtgttggctgaactt
gtctatgcgatcgaagaagaattggctgttacacctgtcgatttctttttgagaagaaca
ggcagcctattatttaatatcaattgggcaaaaacgtatgcacagcctgttgttgactat
atggcagatcgttttggctgggatgaagcgacaaaacagaaacatcaaactgaattagac
cgactattccatgaagcagtcgtaccgcttgatgctgaataa

DBGET integrated database retrieval system