KEGG   Bacillus altitudinis: CFN77_04790Help
Entry
CFN77_04790       CDS       T05199                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
balt  Bacillus altitudinis
Brite
KEGG Orthology (KO) [BR:balt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CFN77_04790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease
Motif
Other DBs
NCBI-ProteinID: ATH71528
LinkDB All DBs
Position
954866..956266
Genome map
AA seq 466 aa AA seqDB search
MSNSLFRKKSISELIAATQGEKALRKELGSFDLTMLGIGAIIGTGIFVLTGTGAVTAGPG
LVLSFVIAGLACLFAALSYAEFASTVPVSGSVYTFTYASMGEFLAFIIGWDLILEYMLAA
SAVSAGWSGYFVSFLNGIGIHIPVELTAAPGGLKGQVTYFNLPAFIILMIITFLLYFGIK
ESKRVNNIMVIMKIAVILLFILVAVKYVKPENWTPFVPFGTSGVLSAAALVFFAFIGFDA
VASAAEETKNPSRNLPRGIITSLLICTVLYVVVSAIMTGIVPFMNFEGVSHPVSLVLQVA
GQNWVAGIVDVGAILGMTTVMLVMLYGQTRVMFAMSRDGLVPKVLSKVHPKHKTPYINTL
FFGTLSALMGGFIPLDELASLVNIGTLSAFILISVAVIVMRKTQPDLPRAFRCPAVPLIP
ILAILSCGLLIYKLGTITFVRFLIWLAIGLVVYFLYSRKHSELNKK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattcgttgtttagaaagaagagcatttcagagctaattgcggcaacacaaggg
gaaaaagcgttaagaaaggaattaggatcatttgatttaacgatgcttggcattggggcg
attatcggaacagggatatttgttctgacaggtacaggcgccgtcacagcaggtccagga
cttgttttatcatttgtaattgcgggccttgcttgtttatttgcggcattgtcatatgcg
gaattcgcttccacagtgccagtatcaggatctgtttatacatttacgtacgcatctatg
ggagaatttttagcgtttatcattggctgggatttgatattagaatatatgctagccgct
agtgccgtttcagcaggctggtcaggctactttgtgtcgtttttaaatgggatagggatt
catataccggttgaattaacagcagcaccaggtggtttaaagggtcaagtgacatatttt
aatcttcctgcatttattattttaatgatcatcaccttcttgctgtacttcggtattaaa
gaatcaaaacgagtcaacaacatcatggtcattatgaaaattgcagtgattctgctcttt
attttagtcgctgtgaaatatgtaaaacctgaaaactggacaccattcgttccttttgga
acttcaggtgttttaagtgcagcagctcttgtcttctttgcatttatcggatttgatgca
gttgcttctgcagcagaggagacaaaaaatccatcacgcaacttgccaagagggatcatt
acttccttattgatttgtactgtgttgtatgtggtggtcagtgcgatcatgacaggtatc
gttccattcatgaattttgagggagtatctcatccagtgtctcttgttttacaagtagcc
ggtcaaaattgggtggcgggtattgtagatgttggggcgattttagggatgaccacggtc
atgcttgtcatgctgtatggccaaacacgtgtcatgtttgccatgtctcgtgatggcttg
gtaccaaaggttctttcaaaggttcatccaaaacataaaacaccttatatcaatactctt
ttctttgggacattgtcagcattaatgggtggattcattccgcttgatgagttggcaagt
ctagtgaacatcggaacactttcagctttcattttgatttcagttgctgtcattgtcatg
agaaaaacacagcctgatttaccgagagcattcagatgccccgcagtgccgctcattcca
atcttggctattctatcttgcggactgctcatttataagcttggtaccatcacatttgtt
cgtttcttaatctggctagccattggacttgttgtctatttcttatattcaagaaagcac
tccgaattaaacaaaaaataa

DBGET integrated database retrieval system