KEGG   Bacillus altitudinis: CFN77_08065Help
Entry
CFN77_08065       CDS       T05199                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
balt  Bacillus altitudinis
Brite
KEGG Orthology (KO) [BR:balt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:balt01001]
    CFN77_08065 (pknB)
Enzymes [BR:balt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CFN77_08065 (pknB)
Protein kinases [BR:balt01001]
 Serine/threonine kinases: Other
  Bacterial family
   CFN77_08065 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like RIO1 Kdo Haspin_kinase PBP1_TM Seadorna_VP7 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ATH72150
LinkDB All DBs
Position
1563705..1565660
Genome map
AA seq 651 aa AA seqDB search
MLIGKRISGRYQILRAIGGGGMANVYLAEDMILDREVAIKILRFDFASDDDFIRRFRREA
QSAASLDHPNIVSIYDVGEEDDIYYIVMEYVEGMTLKEYIHANGPLHPKEAVRIMEQVVA
AMEEAHAKQLVHRDIKPHNILIDNLGNIKVTDFGIAMALSSATITHTNSVLGSVHYLSPE
QARGGLATKKSDIYSLGIVLYELISGRMPFEGESAVSVALKHLQSEPPSVRRWNPSVPQS
VENIILKSMAKDPFYRYEDASEMQKDLKTAFDPARLKEKRFVIEEDHEATKAIPIIKDHQ
VDQDNEKTAVHPVQKPKKKEKQKPKKKRKKWPWIVASILFVLTAATILAITVFPGLLFPK
DVEVTDVSGMTVEKAEDTLKKAGFTVASEPIDIADEKIEKGLVVKTDPKIGTKVKEGTEI
QLYQSTGKEKTELPDVTGEKVEKAKELLEKKGFKQVVVEELNDNDTESGIVMEQKPSANT
ELVAADEEVTLTVSIGPADITLRDLTTYSKQAASNYLEDNGLKLDEKEAYSDDVPKGEVM
KQEPGAGTAVKPGDTVKITFSLGPKEKPAKTVTEKIAIPYEPETEGQEMNVQISIDDAEH
SISDLYETFKITAPTERTIKFKIEPGQKGYYQVTVDDKVVSSKTIEYPDDE
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgttgatcggaaaaaggatcagcggccgttatcaaattcttcgcgccataggcggaggc
ggaatggccaacgtttatttggcggaggatatgattttagatcgcgaagtggcgattaaa
attttacggtttgactttgcaagcgatgatgattttattagacggttccggagagaagcg
caatcagcagccagcttagatcatccgaatattgtcagtatctacgatgtaggagaagaa
gatgacatttattatattgtcatggaatatgtcgaagggatgacgctgaaagaatacata
cacgccaatggaccgcttcacccaaaagaagctgttcgcattatggagcaagtcgttgcg
gcgatggaagaagcccatgcgaaacagctcgtccatcgagacattaagcctcacaatata
ttaatagacaacttggggaatatcaaagtcactgattttggcattgccatggcacttagc
tcagcgaccattacccatacgaattctgttcttggctccgtgcattatttgtccccagag
caagcgcgcggcggtcttgcaacgaaaaagtcagacatttattcacttggtattgttctt
tatgagctgatttcaggacgcatgccatttgaaggagaatccgctgtcagtgtggcactg
aagcatttgcaatcagagccgccatctgtgagaagatggaatccttctgttccgcaaagc
gtggagaacatcattttaaaatcgatggccaaagatccattctatcgatacgaagatgca
tctgaaatgcaaaaagacttaaaaacggcttttgaccctgcaagactaaaagaaaagcgc
tttgtcattgaagaagatcatgaagcaacaaaagccattcctattataaaagatcatcaa
gtcgatcaagacaatgaaaaaacagccgtccacccggttcaaaaaccaaagaaaaaagag
aaacaaaaaccgaagaaaaaacggaaaaaatggccgtggattgtagcatcgatcttattt
gttttgacggctgcgaccattttagcgatcacggtcttcccaggattactctttccaaaa
gacgtagaggtaaccgatgtttctggcatgacggttgaaaaagcggaagacaccttgaag
aaagccggatttaccgtcgcttctgaacccattgatattgccgacgagaagattgaaaaa
gggctggttgtcaaaacagacccgaaaatcggaacgaaggtaaaagaagggacagaaatt
cagctttatcaaagtacaggtaaagaaaaaaccgaattacctgatgtaacaggtgaaaag
gtcgagaaagcaaaagaactattagagaaaaaagggtttaaacaggttgttgtagaggaa
ttgaatgataatgacacagaatcaggcattgtcatggaacagaaaccttctgcgaataca
gaacttgtcgcagcagatgaagaagtcacattgaccgtcagtataggccctgccgatatt
accttacgggatttaacgacgtatagtaaacaggccgcatcaaattatctagaggataat
ggactaaagctagatgaaaaagaagcatattctgacgatgtgccaaaaggtgaggtcatg
aagcaggaaccgggagcggggacagctgttaaacctggtgatacggttaaaattacgttc
tctcttggcccaaaagagaaaccggctaaaacggtgactgaaaagattgcgatcccgtat
gaaccagaaacagaaggacaagaaatgaatgttcaaatatctattgatgacgcagaacat
agcatttctgatttatatgaaacctttaaaatcactgcgcccactgagcgaacgattaaa
tttaagatagaacctggtcaaaaaggatactatcaggtgacagtggatgataaagtagta
agctccaaaacgattgaataccctgatgatgaataa

DBGET integrated database retrieval system