KEGG   Bacillus altitudinis: CFN77_09595Help
Entry
CFN77_09595       CDS       T05199                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
balt  Bacillus altitudinis
Pathway
balt00010  Glycolysis / Gluconeogenesis
balt00053  Ascorbate and aldarate metabolism
balt00071  Fatty acid degradation
balt00280  Valine, leucine and isoleucine degradation
balt00310  Lysine degradation
balt00330  Arginine and proline metabolism
balt00340  Histidine metabolism
balt00380  Tryptophan metabolism
balt00410  beta-Alanine metabolism
balt00561  Glycerolipid metabolism
balt00620  Pyruvate metabolism
balt00625  Chloroalkane and chloroalkene degradation
balt01100  Metabolic pathways
balt01110  Biosynthesis of secondary metabolites
balt01120  Microbial metabolism in diverse environments
balt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:balt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFN77_09595
   00053 Ascorbate and aldarate metabolism
    CFN77_09595
   00620 Pyruvate metabolism
    CFN77_09595
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFN77_09595
   00561 Glycerolipid metabolism
    CFN77_09595
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFN77_09595
   00310 Lysine degradation
    CFN77_09595
   00330 Arginine and proline metabolism
    CFN77_09595
   00340 Histidine metabolism
    CFN77_09595
   00380 Tryptophan metabolism
    CFN77_09595
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFN77_09595
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CFN77_09595
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CFN77_09595
Enzymes [BR:balt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CFN77_09595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ATH72447
LinkDB All DBs
Position
1867886..1869313
Genome map
AA seq 475 aa AA seqDB search
MRNQEKHFINGEWVASTGNETTEVINPATEEVIGTISLGTKEDLDQAVKAARAAFPSFSK
TSRNERVEMLENIVRGYEKRKDELVEVMTKELGAPLKVSEEVHYKMGYEHFSKAAEALKS
YTFTEDRGGHTIIKEAIGVSGLITPWNFPTNQTSLKIAGAIAAGSTVVLKPAEITPFAAM
ILAEIIDEAGVPKGVFNLVNGTGDVIGDGISSHPDIDFVSFTGSGAVGSKIMENAADNVK
KVALELGGKSPLIVLDDADVDEAAETALHHIAMNTGQVCSAATRVLIPESMKDKFEKALL
NALPKFTVGDPREDHATGPLVSKKQWDTVQSYIEKGIEEGATLLAGGTGKPDGIEKGYFA
KHTIFTNVKNDMTIAQEEIFGPVMSVITYQDLDHALEIANDTVYGLAGYVVGQDEKTLKY
VAEHIRAGQITINNAETDYFAPFGGFKQSGIGREWGDFGIEEYLEVKAVMGLPTA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatcaagagaaacactttattaatggagaatgggtcgcatcaacaggaaacgaa
acgacggaggtcattaaccctgcgacagaggaagtcatcggcaccattagtttaggaacg
aaagaagatttagatcaagctgtcaaagcagctcgagccgccttcccttctttctcaaaa
acatctcgaaatgaacgagtagaaatgctggaaaacattgtgcgcgggtacgaaaaacgc
aaggatgaacttgtagaagtgatgacaaaagagcttggtgcaccgctgaaagtgtccgaa
gaagttcattacaaaatgggttatgaacatttttctaaagcagcggaagcactgaaatct
tatacatttaccgaagaccgcggtggacatacgattataaaagaggcgattggtgtcagt
ggattgattacaccgtggaacttcccgacgaatcagacatctcttaaaattgcgggtgcc
attgcggcaggctcaacagttgtcttaaaaccagcggaaattaccccttttgctgcgatg
attcttgcagaaattattgatgaagcaggtgtaccgaaaggagtcttcaacttagtaaac
ggaacgggtgacgtgattggtgacggcattagctcacatcctgatattgacttcgtttca
tttacaggatcaggtgccgtcggctctaaaattatggaaaacgcagcggacaatgtgaag
aaagtagcacttgagcttggcggaaaatcccctcttatcgtcttagacgatgcagatgtg
gacgaagcagcagaaacagctcttcatcatattgcaatgaacacaggtcaagtatgctct
gcagctacacgtgtgctgattccagaatcaatgaaagacaagtttgaaaaagcgctgctg
aacgccctgccgaagtttacagttggtgatccgagagaagatcacgctactggcccgctt
gtttctaaaaagcagtgggatacggtgcaatcttatattgaaaaaggaatcgaagaaggt
gctacccttcttgctgggggaactggaaagccagacggaatcgaaaaaggatatttcgcc
aagcataccattttcaccaatgtgaaaaatgatatgaccattgcgcaagaagaaatcttt
gggccagtcatgagtgtgatcacgtatcaagacctcgatcatgcccttgagatcgccaac
gatacagtgtatggtcttgccgggtatgttgttggtcaagatgaaaaaacattaaaatat
gtcgctgaacatattcgtgccggtcaaatcactattaacaatgcagaaacagattacttt
gccccatttggcggctttaagcagtctggtatcggaagagaatggggagacttcggtatc
gaggaatatttagaagtgaaagctgtgatggggcttccaacggcgtaa

DBGET integrated database retrieval system