KEGG   Bacillus altitudinis: CFN77_13740Help
Entry
CFN77_13740       CDS       T05199                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
balt  Bacillus altitudinis
Pathway
balt00020  Citrate cycle (TCA cycle)
balt00480  Glutathione metabolism
balt01100  Metabolic pathways
balt01110  Biosynthesis of secondary metabolites
balt01120  Microbial metabolism in diverse environments
balt01130  Biosynthesis of antibiotics
balt01200  Carbon metabolism
balt01210  2-Oxocarboxylic acid metabolism
balt01230  Biosynthesis of amino acids
Module
balt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
balt_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:balt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFN77_13740
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CFN77_13740
Enzymes [BR:balt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CFN77_13740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ATH73235
UniProt: A0A0B0QB72
LinkDB All DBs
Position
complement(2647121..2648392)
Genome map
AA seq 423 aa AA seqDB search
MSQGEKITVTGGVLNVPNNPIIPFIEGDGIGPDIWKAASRVLEAAVEKAYKGEKQITWKE
VYAGEKAYNKTGEWLPEQTLEDIREYLIAIKGPLTTPIGGGIRSLNVALRQELDLFTCLR
PVRWFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSDEVKKLIDFLKNELGVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIQYAIDQGRKSVTLVHKGNIMKFTEGAFKNWGYEVA
EKEFGDKVFTWAQYDRIVEQDGKDAANKAQSEAEAAGKIIVKDSIADIFLQQILTRPAEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLLLEHLGWQEAADLVIQSVEKTIASKVVTYDFARLMDGATEVKCSEFADELIK
NLS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacaaggcgaaaaaattacagttactggcggcgtattgaatgtaccaaataatcca
attatcccgtttatcgaaggggacggaatcggtcctgacatttggaaagcagcatcaaga
gttcttgaagcagctgtagaaaaagcatataaaggtgaaaagcaaatcacttggaaagaa
gtatatgcaggtgaaaaagcttacaataaaactggcgagtggcttccagagcaaacactt
gaagacattcgtgaatatttaatcgcgatcaaaggaccactgacaacaccaattggcgga
ggaatccgttcattgaacgtggcactaagacaagagcttgatttattcacatgcttacgt
ccagttcgctggttcaaaggtgtgccatctcctgtgaaacgtccagaagacacagacatg
gtcatcttccgtgaaaacactgaagatatctatgcaggaatcgagtatgcaaaaggatca
gacgaagtgaagaagttaatcgacttcttgaaaaacgaattaggtgtgaataaaatccgt
ttcccagaaacatcaggtatcggaatcaaaccagtttctgaagaaggaacatctcgtctt
gtcagagcagcgatccaatatgcgattgaccaaggccgtaaatctgtgacgcttgttcac
aaaggaaacatcatgaaatttacagaaggagccttcaaaaactggggctacgaagtggct
gaaaaagagtttggcgacaaagtctttacatgggcacaatatgatcgtattgtagaacaa
gatggaaaagatgcggcaaacaaagcgcaaagtgaagcagaagctgctggtaaaatcatt
gtcaaagacagcattgcagatattttccttcaacaaattttaactcgtccagctgagttc
gatgttgtcgcaacaatgaacttaaacggagactacatctctgatgcacttgcagcacaa
gttggtggaattggtatcgcacctggtgcaaatatcaactacgaaacaggacacgctatt
tttgaagcgactcacggaacagcaccgaaatatgctggtcttgataaagtgaatccatct
tctgttcttctatcaggcgtgcttttacttgagcaccttggatggcaagaagctgctgat
ctagtgattcaatctgttgaaaaaacaattgcatctaaagtcgtcacttacgattttgct
agattaatggatggtgcaacagaagtgaaatgttctgagtttgctgacgagctcatcaaa
aacttgtcttga

DBGET integrated database retrieval system