KEGG   Bacillus altitudinis: CFN77_13770Help
Entry
CFN77_13770       CDS       T05199                                 

Gene name
pfkA
Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
balt  Bacillus altitudinis
Pathway
balt00010  Glycolysis / Gluconeogenesis
balt00030  Pentose phosphate pathway
balt00051  Fructose and mannose metabolism
balt00052  Galactose metabolism
balt00680  Methane metabolism
balt01100  Metabolic pathways
balt01110  Biosynthesis of secondary metabolites
balt01120  Microbial metabolism in diverse environments
balt01130  Biosynthesis of antibiotics
balt01200  Carbon metabolism
balt01230  Biosynthesis of amino acids
balt03018  RNA degradation
Module
balt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
balt_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:balt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFN77_13770 (pfkA)
   00030 Pentose phosphate pathway
    CFN77_13770 (pfkA)
   00051 Fructose and mannose metabolism
    CFN77_13770 (pfkA)
   00052 Galactose metabolism
    CFN77_13770 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    CFN77_13770 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CFN77_13770 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:balt01009]
    CFN77_13770 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:balt03019]
    CFN77_13770 (pfkA)
Enzymes [BR:balt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CFN77_13770 (pfkA)
Protein phosphatases and associated proteins [BR:balt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CFN77_13770 (pfkA)
Messenger RNA biogenesis [BR:balt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CFN77_13770 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ATH74443
UniProt: A0A0B0QEK3
LinkDB All DBs
Position
complement(2654018..2654977)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHNVEVYGIYNGYSGLINGKIEKLEIGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKFGIEGLVVIGGDGSFMGAKKLTELGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWS
GLAGGAESILIPEADYDMDEIIARLRRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETSL
ETRVSVLGHIQRGGSPSAFDRVLASRLGAYAVELLLEGRGGRCVGIQSNELVHHDILDIL
DKKHTVDQNMYRLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacgagcggtggggattccccaggaatgaatgcagctgtg
cgcgcagttgtaaggaaagcaatttaccataatgtagaagtttacggtatttataatgga
tattcaggtctaattaacggtaaaattgagaaactcgaaataggttcagtaggcgatatc
attcatcgtggaggaacaaaactttacacggcaagatgtcctgaattcaagacagttgaa
ggtcgtgaaaaagggattgagaacttaaaaaaattcggtattgaaggacttgttgtcatc
ggtggagatggctcattcatgggagcgaagaaattaacagagctcggtttcccatgtgta
ggtgtccctggcacgattgacaatgacattcctggtactgatttcactattggctttgat
acagcactaaatacagtcattgatgccattgataaaattcgtgatacagccacatctcat
gaacgtacatacgtagtggaagtaatgggaagacatgctggggatattgccctttggtca
ggtcttgcaggcggagctgaatcgattttgattcctgaagcagactatgacatggacgaa
attattgccagattgagaagaggacatgagcgcggcaagaagcacagtatcatcatcgtc
gcagaaggcgtaggcagcggtgtcgaatttggtaagagaattgaagaggagacaagcctt
gaaacgcgtgtatctgtcttaggacatattcaacgtggaggttctccaagtgcgtttgac
cgagtgctcgcaagtcgcctaggagcgtatgcagtagaacttcttcttgaaggaagaggc
ggacgctgtgtaggtattcaaagcaacgaactcgttcatcacgatattttagacatctta
gataaaaagcatacagtcgatcaaaatatgtaccgactttcacaagagctctctatataa

DBGET integrated database retrieval system