KEGG   Bacillus altitudinis: CFN77_17035Help
Entry
CFN77_17035       CDS       T05199                                 

Definition
(GenBank) undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase
  KO
K02851  UDP-GlcNAc:undecaprenyl-phosphate/decaprenyl-phosphate GlcNAc-1-phosphate transferase [EC:2.7.8.33 2.7.8.35]
Organism
balt  Bacillus altitudinis
Pathway
balt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:balt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:balt01003]
    CFN77_17035
   01005 Lipopolysaccharide biosynthesis proteins [BR:balt01005]
    CFN77_17035
Enzymes [BR:balt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.33  UDP-N-acetylglucosamine---undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
     CFN77_17035
    2.7.8.35  UDP-N-acetylglucosamine---decaprenyl-phosphate N-acetylglucosaminephosphotransferase
     CFN77_17035
Glycosyltransferases [BR:balt01003]
 Polysaccharide
  Bacterial polysaccharide
   CFN77_17035
Lipopolysaccharide biosynthesis proteins [BR:balt01005]
 O-antigen
  CFN77_17035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4 YfzA
Motif
Other DBs
NCBI-ProteinID: ATH73842
UniProt: A0A0B0QCT8
LinkDB All DBs
Position
complement(3265331..3266398)
Genome map
AA seq 355 aa AA seqDB search
MDYERALLAFFVSLATVLIVTPIVKKFAIKIGAVDQPNKRKVHDRVMPRMGGLAIFIGVA
AGALAGGLFLHNKITAISVGAVLIVILGIFDDKYNLSAKFKFLVQVLVACLIVSTGLKMD
FFSVPFLTDRLELGWMAYPLTVLWIVGITNAINLIDGLDGLAAGISVIGLTTIAVMAFSA
DKILILSLSLVVIGSTIGFLFYNFHPAKIFMGDTGSLFLGYMISVLSLLGLYKSVTLFSV
VVPVIILGVPIFDTTFAIIRRILNKQPISSPDKSHIHHRLMAFGLSHRMAVIVIYMIGLV
FSLSAILLTSATIWLSLIIIFLLVMFMQVIAEVTGLVNEEFKPFTKFYKRMVKRQ
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggattacgaacgcgccttattagcgttttttgtctctctggctacagttttaattgtg
acaccaatcgtcaaaaagtttgcaattaagattggtgcagtggaccagccgaataaacga
aaagttcatgatagagtaatgcctcgaatgggcggtttggcgatttttattggggtagcg
gctggagcactagcaggcgggctgtttctacataataaaattacagctatatcagttggc
gctgtactcatcgtcattttaggtatatttgatgataaatataatttaagtgcaaaattc
aaatttcttgtgcaagttctcgttgcttgcttaatcgtgagcacgggcttaaaaatggac
tttttctctgttcctttcttaacagatcgactggagttaggatggatggcgtatcccctg
actgtactatggattgttgggattacaaatgcgatcaatttaattgacggattagatgga
ctggctgccggaatttcggttatcggtttaaccacgattgccgtcatggcattttctgcg
gacaagatcctgattctttcgttatctcttgtcgtcattggcagtaccatcggttttctt
ttttataacttccatccagcaaaaatatttatgggtgatacaggttcgttatttttaggc
tatatgatctcggtcctgtcacttttaggattgtacaaaagtgttactttgtttagtgtt
gttgtccctgtaattattttaggtgtgcctatttttgatacgacctttgcgatcataaga
cgaatattgaataaacagcctatctcatcacctgacaaatcacacatccatcatcgactg
atggcctttggcttatcacatcgaatggcagtgattgtgatttacatgattggcttagtc
ttcagcttaagcgcgattttgctgacaagtgccaccatttggctgtcattgatcatcatc
tttttactggtcatgtttatgcaagttatcgctgaagtcactggtttggtgaacgaagag
tttaaaccatttacgaaattctacaaacgtatggtcaaaagacaataa

DBGET integrated database retrieval system