KEGG   Burkholderia ambifaria AMMD: Bamb_0306Help
Entry
Bamb_0306         CDS       T00398                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00550  Peptidoglycan biosynthesis
bam01100  Metabolic pathways
bam01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bamb_0306
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Bamb_0306
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bam01003]
    Bamb_0306
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bam01011]
    Bamb_0306
Enzymes [BR:bam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Bamb_0306
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Bamb_0306
Glycosyltransferases [BR:bam01003]
 Polysaccharide
  Bacterial polysaccharide
   Bamb_0306
Peptidoglycan biosynthesis and degradation proteins [BR:bam01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Bamb_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ABI85866
UniProt: Q0BJ07
LinkDB All DBs
Position
1:complement(345277..347670)
Genome map
AA seq 797 aa AA seqDB search
MPMQSTSPTSPPPPPEPKKRPWWQKALIGVAAMCVALVVAGGLVLGYALVVAWPNMPSLD
ALTDYRPKVPLRIYTSDHVLIGEFGEERRDIVHFKEVPDSLKKAILAIEDARFYDHGGVD
LTGIARAGFVALTNGHASQGASTITMQVARNFFLSSEKTYTRKIYEMLLAYRIERALTKD
QILEVYMNQIYLGQRAYGFASAARVYFGKDLKDITLAEAAMLAGLPKAPSAYNPVVNPKR
AKVRQEYILQRMLELNFITREQYDEAAAQPLVVKGAGREFSVHAEYVAEMVRQMMYAQYR
EETYTRGFNVVTTIDSADQQVAYTALRKGIMDYERRHGYRGPEGFIELPAGADDREQAID
DALLEHPDNGELIAAVVTAATPRQITVAFIDGSTATIEGDNLRFASGALSANAQPNRRIR
PGAIVRVVKNDAGKWSITQLPQVEGAFISIVPQDGAIRSLVGGFDYNKNKFNHVTQAWRQ
PGSSFKPFIYSASLDKGLGPATVINDGPLYFSAAETGGQPWEPKNYGGGFEGPMSMRTAL
QRSRNLVSIRILNQIGTKYAQQYITRFGFDADRHPAYLPMALGAGQVTPLQMAGAYSVFA
NGGFRVNPYLIAEVTDPNGAIVARAQPLIAEQNAPRAIDARNAYVTNSLLQSVAQRGTGA
RTNVLKRTDLAGKTGTTNDSHDAWFAGYQHTLAAIAWIGYDNPRSLGDRETGGGLSLPVW
IEYMGAALKGVPEFKPTMPDDVQSIGGELYFTEFTPGHGFVSTVGVPQAPAVQDTEEPVP
HVDEQEKQDIMNLFRGH
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgcaatccacgtctcctacgtccccgcctcccccgccggagccgaagaaacgg
ccctggtggcagaaagccctgatcggcgtcgccgcgatgtgcgtggccctcgtcgtggcc
ggcggcctcgtgctcggctacgcgctcgtcgtcgcgtggccgaacatgccgtcgctcgac
gcgctgaccgactatcgtccgaaggtaccgctgcgcatctacacgtccgatcacgtgctg
atcggcgaattcggcgaggaacgccgcgacatcgtccatttcaaggaggtgcccgactcg
ctcaagaaggcgatcctcgcgatcgaggacgcacgcttctacgatcacggcggcgtcgac
ctcaccggcatcgcccgcgccggcttcgtcgcgctgacgaacggccatgcgtcgcagggc
gcgagcacgatcacgatgcaggtcgcgcgcaacttcttcctgtcgagcgagaagacctac
acgcgcaagatctacgagatgctgctcgcgtaccgcatcgagcgcgcgctgacgaaggat
cagattctcgaggtctatatgaatcagatctatctcggccagcgtgcgtacggcttcgcg
agcgccgcgcgcgtgtatttcggcaaggacctgaaggacatcacgctcgcggaagcggcg
atgctagcggggctgccgaaggcgccgtccgcgtataacccggtcgtcaacccgaagcgc
gcgaaggtccgccaggaatacatcctgcagcggatgctcgagctgaacttcatcacgcgc
gagcagtacgacgaggctgccgcgcagccgctcgtcgtcaagggcgcgggccgcgagttc
agcgtgcacgccgagtacgtcgcggaaatggtccggcagatgatgtatgcgcagtaccgc
gaggaaacctacacgcgcggcttcaacgtcgtcacgacgatcgattccgccgaccagcag
gtcgcgtacaccgcgctgcgcaagggcatcatggattacgagcgtcgccacggctatcgc
gggccggaaggcttcatcgagctgccggccggcgccgacgaccgcgaacaggcgatcgac
gacgcgctgctcgagcatcccgacaacggcgaattgatcgcggcggtcgtcaccgcggcc
accccgcgccagatcacggtagccttcatcgacggcagcaccgcgacgatcgaaggcgac
aacctgcgcttcgcgtcgggcgcgctgtcggccaacgcgcagccgaaccgccgcatccgc
ccgggcgcgatcgtccgtgtcgtgaagaacgacgccggcaagtggtcgatcacgcagttg
ccgcaggtcgagggcgcgttcatctcgatcgtcccgcaagacggcgcgatccgctcgctc
gtcggcggcttcgactacaacaagaacaagttcaaccacgtcacgcaggcgtggcggcaa
ccgggttcgtcgttcaagccgttcatctactcggcgtcactcgacaagggcctcgggccg
gccacggtgatcaacgacggcccgctgtatttcagcgccgcggaaaccggcggccagccg
tgggaaccgaagaactacggcggcggcttcgaaggtccgatgtcgatgcgcaccgcgctg
cagcgctcacgcaacctcgtgtcgatccggatcctgaaccagatcggcacgaagtacgcg
cagcagtacatcacgcgcttcggcttcgacgccgaccgccatccggcctacctgccgatg
gcgctcggtgcgggccaggtcacgccgctgcagatggccggcgcgtactcggtgttcgcg
aacggcggcttccgcgtgaacccgtatctgatcgccgaagtgaccgatccgaacggcgcg
atcgtcgcacgcgcgcagccgctcatcgccgagcagaacgcgccgcgcgcgatcgacgca
cgcaacgcgtacgtgacgaacagcctgctgcagagcgtcgcgcagcgcggcacgggcgca
cgcaccaacgtgctgaagcgcaccgacctcgcgggcaagactggtacgacgaacgactcg
cacgacgcgtggttcgccggctaccagcacacgctcgcggcgatcgcatggatcggctac
gacaatccgcgcagcctcggcgatcgcgaaaccggcggcggcctgtcgctgccggtctgg
atcgaatacatgggtgcggcgctgaagggcgtgccggagttcaagccgacgatgccggac
gacgtccagtcgatcggcggcgagctgtacttcaccgagttcacgccggggcacggcttc
gtatcgacggtcggcgtgccgcaggcgccggctgtgcaggacaccgaggaaccggtgccg
cacgtcgacgagcaggaaaagcaggacatcatgaacctgttccgcggccactga

DBGET integrated database retrieval system