KEGG   Burkholderia ambifaria AMMD: Bamb_0311Help
Entry
Bamb_0311         CDS       T00398                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01130  Biosynthesis of antibiotics
bam01230  Biosynthesis of amino acids
Module
bam_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bamb_0311
Enzymes [BR:bam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Bamb_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 AAA APS_kinase AAA_16 TsaE FtsK_gamma Cytidylate_kin AAA_22
Motif
Other DBs
NCBI-ProteinID: ABI85871
UniProt: Q0BJ02
LinkDB All DBs
Position
1:352011..352565
Genome map
AA seq 184 aa AA seqDB search
MQARDPHANVFFVGLMGAGKTTVGRAVARRLDRTFFDSDHEIEARTGARIPVIFEMEGEA
GFRDRESQVIADLTQRENIVLATGGGAVLRAENRDCLKGHGIVIYLRANPHDLWLRTRKD
KNRPLLQTGDPKARLEALYEVRDPLYRECADFIIETGRPSVNGLVNMVLMQLELAGVIAK
PLQA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagcgcgggacccacacgcaaacgtatttttcgtcggccttatgggagcgggtaag
accaccgtgggccgtgcggtcgcgcgccggctcgacaggacgttcttcgactccgaccac
gaaatcgaggcccgcacgggtgcgcgcattccggtgatcttcgagatggaaggcgaggcc
ggctttcgcgaccgcgaatcgcaggtgatcgcggatctcacgcagcgcgagaacatcgtg
ctcgcgacgggcggcggcgcggtgttgcgcgccgaaaatcgcgattgcctgaaaggccac
ggcatcgtcatctatctgcgcgccaatccgcacgatctgtggctgcgcacgcgcaaggac
aagaaccgcccgctgttgcagaccggcgacccgaaggcgcgtctcgaagcgctctacgaa
gtgcgcgatccgctgtaccgcgaatgcgcggacttcatcatcgagaccggccgtccgtcg
gtcaacggcctcgtcaacatggtgctgatgcaactcgaactcgcaggcgtcatcgccaag
ccgctacaagcatga

DBGET integrated database retrieval system