KEGG   Burkholderia ambifaria AMMD: Bamb_1391Help
Entry
Bamb_1391         CDS       T00398                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00020  Citrate cycle (TCA cycle)
bam00310  Lysine degradation
bam00380  Tryptophan metabolism
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01120  Microbial metabolism in diverse environments
bam01130  Biosynthesis of antibiotics
bam01200  Carbon metabolism
Module
bam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bamb_1391
  09105 Amino acid metabolism
   00310 Lysine degradation
    Bamb_1391
   00380 Tryptophan metabolism
    Bamb_1391
Enzymes [BR:bam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bamb_1391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABI86949
UniProt: Q0BFX4
LinkDB All DBs
Position
1:1532934..1534211
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQIIATIDTEAKAGAAEAAAGAAEVKPAAAPAAAAPAAQPAAAVASSSAA
ASPAASKLLAEKGLSAGDVAGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPALPE
VKVPASAATWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtgtcggaagccaccatg
ctgcagtggaagaagaagccgggcgaagcagtcgcgcaggacgaaatcctgatcgaactc
gagaccgacaaggtcgtgctcgaagtgccggcaccggccgcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgttgccgaccagatcatcgcgacgatcgacaccgaa
gcgaaggcaggtgctgccgaagccgccgcaggcgccgccgaagtgaagccggcagcagca
cctgctgcagccgcaccggcagcccagccggctgccgctgtcgcatcgagctcggctgcc
gcatcgccggccgcgtcgaagctgctggccgagaagggcctgtcggcaggcgacgtcgca
ggttcgggccgcgatggccgcgtcacgaagggcgacgcgctcgcagctggcagcgcaccg
aaggccgctccggccgccgccccggcgaagaccgccgctgcgaagccggcgctgccggaa
gtgaaggtgccggcgtcggcagcgacgtggctgaacgaccgtccggaacagcgcgtgccg
atgtcgcgcctgcgtgcgcgtatcgccgagcgtctgctcgagtcgcagcagaccaacgcg
atcctgacgacgttcaacgaagtgaacatggctccggtcatggaactgcgtaacaagtac
aaggacaagttcgagaaggaacatggcgtgaagctcggcttcatgtcgttcttcgtgaag
gcggccgtgcacgcgctgaagaagttcccgctggtgaacgcgtcgatcgacggtaacgac
atcgtctatcacggctacttcgacatcggtatcgcggtcggttcgccgcgcggcctggtc
gtgccgatcctgcgcaatgcggatcaactgagcctcgccgagatcgagaagaagatcgcc
gaattcggtcagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggtacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaacccg
ccgcagtcggccatcctcggcgtgcacgcgacgaaggagcgcccggttgtcgaaaacggc
cagatcgtgatccgtccgatcaactacctggcgctgtcgtacgaccaccggatcatcgac
ggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagatccggcacgc
ctgctgctcgatctgtaa

DBGET integrated database retrieval system