KEGG   Burkholderia ambifaria AMMD: Bamb_1492Help
Entry
Bamb_1492         CDS       T00398                                 

Definition
(GenBank) nodulation ABC transporter NodI
  KO
K09695  lipooligosaccharide transport system ATP-binding protein
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bam00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bamb_1492
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bam02000]
    Bamb_1492
Transporters [BR:bam02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipooligosaccharide transporter
    Bamb_1492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_15 AAA_22 AAA_23 T2SSE AAA_27 AAA_29
Motif
Other DBs
NCBI-ProteinID: ABI87050
UniProt: Q0BFM3
LinkDB All DBs
Position
1:complement(1636568..1637548)
Genome map
AA seq 326 aa AA seqDB search
MPSQPAGRPRNASVPAYNDKLPMSVAPIDFRNVEKRYGDKLVVNDLSFHVQAGECYGLLG
PNGAGKTTTLKMLLGLVYPDAGAISLCGEPVPTRARHARRRVGVVPQFDNLDPDFTVREN
LLVFSRYFGMSAQAARALVQPLLEFAKLENKADAKVGELSGGMKRRLTLARALVNDPDVL
VLDEPTTGLDPQARHLMWERLRSLLARGKTILITTHFMEEAERLCDRLCVIEEGRKIAEG
APHALIESEIGCDVIEIYGPEPVALRDELAPFAKHTEISGETLFCYVTDPEPLSARLKGR
TGLRYLHRPANLEDVFLRLTGREMQD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtcagccagccggccggccgcgaaacgcgtccgtgcccgcttacaacgacaaa
ctgcccatgtccgttgcaccgatcgatttccggaacgttgaaaagcgctatggcgacaag
ctcgtcgtcaacgacctctccttccacgtgcaggccggcgaatgctacggcctgctcggg
ccgaacggcgccggcaagaccacgacgctgaagatgctgctcggcctcgtgtatcccgat
gccggcgccatttcactgtgcggcgagcccgttccgacacgcgcgcggcatgcgcgccgg
cgcgtcggggtcgtcccgcagttcgacaatctcgatccggacttcacggtccgcgaaaac
ctgctcgtgttcagccgctatttcgggatgtcagcgcaggccgcacgcgcgctcgtgcag
ccgctgctcgaattcgcgaaactggaaaacaaggccgatgccaaggtgggcgaactgtcg
ggcgggatgaagcggcgtctgacgctcgcccgcgcgctcgtcaacgatcccgacgtgctg
gtgctcgacgaaccgaccacaggcctcgatccgcaggcgcggcacctgatgtgggagcgg
ttgcgctcgctgctcgcgcgcggcaagacgatcctgatcaccacgcatttcatggaggaa
gccgaacgcctgtgcgaccggctgtgcgtgatcgaggaaggccgcaagatcgccgaaggc
gcgccgcatgcgctgatcgaatccgagatcggctgcgacgtgatcgagatctacgggccc
gagccggtcgcgttgcgcgacgagctggcgccgttcgcgaagcacaccgagatcagcggc
gaaacgctgttctgctacgtgaccgatcccgagccgctcagtgcgcgactcaagggacgc
acggggttgcgctatctgcatcgtccggccaatctggaagacgtattcctgcggctcacg
ggccgcgaaatgcaggactga

DBGET integrated database retrieval system