KEGG   Burkholderia ambifaria AMMD: Bamb_1682Help
Entry
Bamb_1682         CDS       T00398                                 

Definition
(GenBank) Betaine-aldehyde dehydrogenase
  KO
K00130  betaine-aldehyde dehydrogenase [EC:1.2.1.8]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00260  Glycine, serine and threonine metabolism
bam01100  Metabolic pathways
Module
bam_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bamb_1682
Enzymes [BR:bam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.8  betaine-aldehyde dehydrogenase
     Bamb_1682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007
Motif
Other DBs
NCBI-ProteinID: ABI87239
UniProt: Q0BF34
LinkDB All DBs
Position
1:complement(1859569..1861077)
Genome map
AA seq 502 aa AA seqDB search
MAVNRHTSGRKRSLECRLPWRRKTMKIYDQFYIDGAWRKPAGTGTIDVIDSGTEAVIGRI
PEGVASDAQDAIRAARAAFDAWAATPAATRAGYLRKIVERLQARSEELAQSITGEVGMPI
KLSRAIQVGGPIYNWKAYAKLAESFEFEATVGNSLVVREPVGVVAAITPWNYPLNQITLK
VAPALAAGCTVVLKPSEVAPLNAFMLAEAIHEAGLPPGVFNLVCGYGPVVGEVLATDPDV
DMVSFTGSTRAGKRVAELAAAGVKRVALELGGKSASVILDDADFAAAVKGTVNACYLNAG
QTCSAHTRMLVPEARYEEAREIAKKAAEAYVAGDPRDETTRLGALASAAQQQRVQAYIQR
GIDDGAELVTGGTGLPEGLAKGFFVKPTVFGRVDPKSTIAQEEIFGPVLSIITYRDEDEA
VRIANDSPYGLGGAVWAGSDERAMRVARRIRTGQVDINGGMWNGAAPFGGYKQSGHGREN
GVYGLEEYLEYKSMQLKPANPA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaatcgtcacaccagcggacggaaacgctcgctagaatgtcggcttccctgg
aggcggaaaacgatgaaaatctacgaccagttctacatcgacggcgcatggcgcaaaccg
gccggcacgggcacgatcgacgtgatcgactcgggtaccgaggccgtgatcggccggatc
cccgaaggcgtcgcgtcggacgcgcaggatgcaatccgcgcggcgcgcgcggcattcgac
gcatgggccgcgacgccggccgcgacgcgcgcgggctacctgcgcaagatcgtcgagcgc
ctgcaggcgcgcagcgaggaactcgcgcagtcgatcaccggcgaagtcggaatgccgatc
aagctgtcgcgcgcgatccaggtcggcggcccgatctacaactggaaggcgtacgcgaag
ctcgccgaatcgttcgaattcgaggcgacggtcggcaactcgctggtcgtgcgcgagccg
gtcggcgtcgtcgcggcgatcacgccgtggaattatccgctcaaccagatcacgctgaag
gtcgcaccggcactcgcggccggctgcaccgtcgtcctgaagccgtccgaagtcgcgccg
ctcaacgcgttcatgctcgccgaagcgattcacgaagcgggcctgccgccgggcgtgttc
aatctcgtgtgcgggtatggcccggtcgtcggcgaggtgctggcgaccgatccggacgtc
gacatggtgtcgttcaccggttcgacgcgtgccggcaagcgcgtggccgaactcgcggcc
gcgggcgtgaagcgtgtcgcgctcgaactcggcggcaagtcggcatcggtgatcctcgac
gatgccgatttcgcggcggcggtgaagggcacggtcaacgcgtgctacctgaacgcgggc
cagacctgttcggcgcacacgcggatgctcgtgccggaggcgcgctacgaagaggcgcgc
gagatcgcgaagaaggcggccgaagcgtatgtcgcgggcgatccgcgtgacgaaacgacg
cgcctcggcgcgctcgcgtcggccgcgcagcagcagcgcgtgcaggcgtatatccagcgc
gggatcgacgacggcgcggaactggtgacgggcggcacgggcctgccggaagggctcgcg
aagggcttcttcgtgaagccgaccgtgttcggccgcgtcgatccgaaatcgacgatcgcg
caggaagagatcttcgggccggtgctgtcaatcatcacgtatcgcgacgaagatgaagcg
gtgcgcatcgcgaacgattcgccgtacgggcttggcggcgcggtgtgggcgggcagcgac
gaacgcgcgatgcgcgtcgcgcggcgcatccgcacggggcaggtcgacatcaacggcggc
atgtggaacggcgccgcgccgttcggcggctacaagcagtcgggacacggccgcgagaac
ggcgtgtacgggctcgaagagtatctcgagtacaagtcgatgcagctcaagccggcgaat
cctgcctga

DBGET integrated database retrieval system