KEGG   Burkholderia ambifaria AMMD: Bamb_2572Help
Entry
Bamb_2572         CDS       T00398                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00020  Citrate cycle (TCA cycle)
bam00480  Glutathione metabolism
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01120  Microbial metabolism in diverse environments
bam01130  Biosynthesis of antibiotics
bam01200  Carbon metabolism
bam01210  2-Oxocarboxylic acid metabolism
bam01230  Biosynthesis of amino acids
Module
bam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bam_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bamb_2572
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bamb_2572
Enzymes [BR:bam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Bamb_2572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ABI88128
UniProt: Q0BCJ5
LinkDB All DBs
Position
1:complement(2833127..2834383)
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDYSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVAHAYK
GKRKIHWMEIFAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIKF
LQDEMGVKKIRFPETSGIGVKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGNEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGEVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggagggcggtgacaagatcaccgtcaacaaggac
tactcgctcaacgtttccgatcagccgatcattccctatatcgaaggcgacggtacgggc
ttcgatatcacgccggtcatgatcaaggtcgtcgacgcggcggtggcccatgcctacaag
ggcaagcgcaagatccactggatggagatcttcgcgggcgagaaggcgacgaaggtgtac
ggtccggacgtgtggctgccggacgaaacgctgcaggtgctgaaggaatacgtggtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgttcgctgaacgtcgcgctg
cgccaggaactcgacctgtacgtgtgcctgcgcccggtccagtatttcaagggcgtgccg
tcgccggtgcgcgagccgcaaaagatcgacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgagtgggccgcgggctccgagcaggcgaagaaggtgatcaagttc
ctgcaggacgagatgggcgtgaagaagatccgcttcccggaaacttcggggatcggcgtc
aagcccgtgtcgaccgaaggcaccgagcgtctcgtgcgcaaggcgatccaatacgcgatc
gacaacgatcgcaagtcggtcacgctggtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgccggctacgcgctcgcgcagaaggaattcggcggcgagctgatc
gacggcggcccgtggatgcgcgtgaagaacccgaagacgggcaacgagatcgtcatcaag
gattcgatcgccgatgcattcctgcagcagatcctgctgcgtccggccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctccgacgcactggccgcgcaggtcggc
ggcatcgggatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaggcgacg
cacggcacggcgcccaagtacgcgggcaaggattacgtgaaccccggttccgagatcctg
tcggcggaaatgatgctgcgccacctcggctggacggaagcggccgacacgatcatcgcc
gcgatggaaaagtcgatcctgcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaggtgtcgtgctccggcttcggcgaagtgctgatcgagaacatgtaa

DBGET integrated database retrieval system