KEGG   Burkholderia ambifaria AMMD: Bamb_2666Help
Entry
Bamb_2666         CDS       T00398                                 

Definition
(GenBank) D-Ala-D-Ala carboxypeptidase PBP3, Serine peptidase, MEROPS family S13
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bamb_2666
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bam01002]
    Bamb_2666
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bam01011]
    Bamb_2666
Enzymes [BR:bam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Bamb_2666
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Bamb_2666
Peptidases [BR:bam01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Bamb_2666
Peptidoglycan biosynthesis and degradation proteins [BR:bam01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Bamb_2666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ABI88222
UniProt: Q0BCA1
LinkDB All DBs
Position
1:2936201..2937817
Genome map
AA seq 538 aa AA seqDB search
MRTCLYNVRSGAPRAPPEPLHFPYSPMPISDLSARFAPRARARVCLRAAAVVATCTALAF
APSAQARKKLHKEARKTAVVSPAARAAGLPASVLVALQRAKVPASAMSVVVERVGDPEPL
IEWNANRPMLPASTMKLVTTFSGLSILGPDFRWRTTAYADGPVDPDGTLQGNLYIKGTGD
PKLVPEELIDLVDKLRKAGVKRVAGGLVLDKSYFAASTRDLPSFDDDVSAPYNVGPDPLL
YAFKAVSFTVTPGDDGKIAVDVLPPLANLSIDNQLYEGSGSCGAAAAAARPTLTAGSGIM
TASFAGDYPLRCGARTTNLAILDHTTFFARGFLALWQQDGGTIAGPVSEGKVPTTARPLA
VHHSPVLGSIVYDINKFSNNVMARNLFLTIGAVAGKPPATPEQSSRAIQAFLRKSGIAMP
DLALENGSGLSRDEHVSALSLAALLQAANASPVAQAFVDSLPVAGIDGTMKNRLTNAGVL
GNAHIKTGTLRDVRAIAGYVAGADGQSYVVVSFINDDHAEAARAAHDTLLEWIYAGAH
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcacttgtctctacaatgtgcgctccggcgcgccgcgcgccccgcccgaacccctg
catttcccgtattcgcccatgccgatttccgatctctccgcccggttcgccccccgcgcc
cgcgcccgcgtctgcctgcgggcggccgccgtcgtcgccacctgcacggcccttgcgttc
gcaccttccgcgcaggcccgcaagaagcttcacaaggaagcgcgcaagaccgccgtcgtg
tcgcccgccgcgcgcgcggccggcctgccggcgtccgtgctggtcgcgctgcagcgcgcg
aaggtgccggcatcggcgatgagcgtcgtcgtcgagcgcgtcggcgatcccgagccgctg
atcgaatggaacgcgaaccggccgatgctgccggcgtcgacgatgaagctcgtcacgacc
ttctcgggcctgtcgatcctcggccccgacttccgctggcgcaccaccgcgtatgcggac
ggcccggtcgatccggacggcacgctgcaaggcaacctgtacatcaagggcaccggcgat
ccgaagctcgtgcccgaggagctgatcgacctcgtcgacaagctccgcaaggcgggcgtc
aagcgcgtggccggcggcctcgtgctcgacaagagctatttcgccgcgtcgacgcgcgac
ctgccgtcgttcgacgacgacgtgagcgcaccgtacaacgtcggccccgatccgctgctg
tacgcgttcaaggccgtgtcgttcacggtgacgccgggcgacgacggcaagatcgccgtc
gatgtgctgccgccgctcgccaatctgtcgatcgacaaccagctgtacgaaggcagcgga
tcgtgcggcgcggccgccgcggccgcgcgtccgacgctgacggccggcagcgggatcatg
accgcgtcgttcgccggcgactatccgctgcgctgcggcgcgcgcacgaccaatctcgcg
atcctcgatcacacgacgttcttcgcgcgcggcttcctcgcgctgtggcagcaggacggc
ggcacgatcgcgggcccggtcagcgaaggcaaggtgcccaccaccgcgcgcccgctcgcc
gtccatcacagcccggtgctcggcagcatcgtctacgacatcaacaagttcagcaacaac
gtgatggcgcgcaacctgttcctgacgatcggcgcggtcgccggcaagccgcctgcgaca
cccgagcagtcgagccgcgcgattcaggcattcctgcgcaagagcgggatcgcgatgccc
gacctcgcgctcgagaacggctcgggcctgtcgcgcgacgagcacgtgagcgcgctgtcg
ctcgccgcgctgctgcaggccgcgaacgcgagcccggtcgcgcaggcgttcgtcgattcg
ctgccggtcgccggcatcgacggcacgatgaagaaccgcctgaccaacgccggcgtgctc
ggcaatgcgcacatcaagacgggcacgctgcgcgacgtgcgcgcgatcgcgggctacgtc
gcgggcgcggacggccagagctacgtcgtcgtcagtttcatcaacgacgatcacgcggaa
gccgcgcgcgccgcgcacgacacgctgctcgaatggatctacgcgggcgcgcactga

DBGET integrated database retrieval system