KEGG   Burkholderia ambifaria AMMD: Bamb_2943Help
Entry
Bamb_2943         CDS       T00398                                 

Definition
(GenBank) penicillin-binding protein 6, Serine peptidase, MEROPS family S11
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00550  Peptidoglycan biosynthesis
bam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bamb_2943
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bam01002]
    Bamb_2943
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bam01011]
    Bamb_2943
Enzymes [BR:bam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Bamb_2943
Peptidases [BR:bam01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Bamb_2943
Peptidoglycan biosynthesis and degradation proteins [BR:bam01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Bamb_2943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ABI88499
UniProt: Q0BBH4
LinkDB All DBs
Position
1:complement(3245685..3246995)
Genome map
AA seq 436 aa AA seqDB search
MRLSPQGLKSLASSIAFGTAARNVALGVMLPVALASTIVVAEAKPAAKAKAAHAAPAAEQ
FTGAPATFMPGAVPPPGVNARSWVLVDATSNTVLASGNADERVEPASLTKLMTAYLVFEA
LDKKKISMEQIITPSEAVRRVGLDESRMFIEANKPVSVHDLVYGMIIQSGNDAAIALAEL
VGGSEGQFVTLMNAEAQRLGMKGTHFADVNGMPDPNHYTTAGDLAKLSAHLIRDFPQYYG
IFSEKEFKYNNIRQGNRNRLLWLDPTVDGLKTGHTQAAGYCLIASAKRAIPGVDGQRRLV
SVMMGEPKEGERTQDSMKMLNYGYSAFDAVRLFKGGQAMSTPRVYKGKESTVQVGVKSDQ
WVTVPRGLGDKVKPEVDVNAPLIAPLAEGQQVGTVKLVADGKTLSEFPVVALQPVPEAGI
FGRIWDSILLMFSKKK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgtctccccaaggcctcaagtccctcgcttcttccatcgccttcggcaccgcc
gcgcgcaacgtcgcgctgggcgtgatgctgcccgtcgcgctcgcatcgacgatcgtcgtc
gccgaggcgaagccggccgccaaggccaaggccgcgcacgcggcgccggccgccgagcag
ttcaccggcgcgcccgcgaccttcatgccgggcgcggtgccgccgccgggcgtgaacgcg
cgctcgtgggtgctcgtcgatgcgacgagcaacacggtgctcgcatcgggcaacgccgac
gaacgcgtcgagcccgcatcgctcacgaagctgatgacggcctacctggtgttcgaggcg
ctcgacaagaagaagatctcgatggagcagatcatcacgccgagcgaggcagtgcgccgc
gtcggcctcgacgagtcgcgcatgttcatcgaggcgaacaagccggtgtcggtgcacgac
ctcgtgtacgggatgatcatccagtcgggcaacgacgccgcgatcgcgctggccgaactg
gtcggcggcagcgaagggcagttcgtcacgctgatgaacgccgaggcgcagcgcctcggc
atgaagggcacgcacttcgccgacgtgaacggcatgcccgatccgaaccactacacgacg
gccggcgacctcgcgaagctgtccgcgcacctgatccgcgattttccgcagtactacggc
atcttctcggagaaggaattcaagtacaacaacatccgccagggcaaccgcaaccggctg
ctgtggctggatccgacggtcgacggcctgaagacgggccacacgcaagcggccggctac
tgcctgatcgcatcggccaagcgcgcgatcccgggtgtcgacggccagcgccgtctcgtg
tcggtgatgatgggcgagccgaaggaaggcgagcgcacgcaggacagcatgaagatgctg
aactacggctatagcgcgttcgacgcggtgcgcctgttcaagggtggccaggcgatgtcg
acgccgcgcgtctacaagggcaaggagagcaccgtgcaggtcggcgtgaagagcgaccag
tgggtgaccgtgccgcgcggcctgggcgacaaggtgaagccggaagtcgacgtcaacgcg
ccgctgatcgcgccgctcgcggaaggccagcaggtcggtaccgtgaagctcgtcgccgac
ggcaagacgctgtcggagttcccggtcgtcgcgctgcagccggtgccggaagcgggtatc
ttcgggcgtatctgggactcgatcctgctgatgttcagcaagaagaagtag

DBGET integrated database retrieval system