KEGG   Burkholderia ambifaria AMMD: Bamb_3500Help
Entry
Bamb_3500         CDS       T00398                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bam  Burkholderia ambifaria AMMD
Brite
KEGG Orthology (KO) [BR:bam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bamb_3500
Enzymes [BR:bam01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bamb_3500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_binding_3 DAO Glutaredoxin Thi4 NAD_binding_8 K_oxygenase FAD_oxidored AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: ABI89054
UniProt: Q0B9W9
LinkDB All DBs
Position
2:complement(308658..310256)
Genome map
AA seq 532 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIGSLTSRVTVTERRDDAE
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQNEVEARQIMAVPTMFLNGES
FGQGRSSVKEILAKLDTGASARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQ
IRLANGAVLKAKTIILATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLLEYGAQLRADEVLQRKLRSLPNVTIVTQAQTTELTGDGSKL
NGLVYKDLRSGEAKRVDLEGVFVQIGLVPNTEWLKGTIELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDVTPATADTPQAEEAIAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaatcaactgaaagcgtacctcgaaaagatcacgcgcccg
atcgaactcgtcgcgtcgctcgacgacagcgcgaagtcgcaggaactgcttgcgctgctc
aacgagattggttcgctgacgtcgcgcgtgaccgtgaccgaacgccgcgacgacgccgag
cgcaagccgtcgttctcgatcggcgaacccggcaagccggcgggcatccgcttcgccggc
atcccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccgatcaagctcgacgacgacgtgatcgaacagatccgcgcgctcgacggcgactacgcg
ttcgaaacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgccacgtcgcgatcgacggcgcgctgttccag
aacgaagtcgaagcgcgccagatcatggccgtgccgacgatgttcctgaacggcgaatcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgacacgggcgccagc
gcacgcgccgcgaagtcgctcgagaacaagccggtgttcgacacgctgatcgtcggcggc
ggcccggccggtgcggccgccgcgatctactcggcgcgcaagggcatcgcgacgggcgtg
gtggccgagcgcttcggcgggcaggtgctcgacacgatggcgatcgagaacttcgtgtcg
gtgcaggaaaccgaagggccgaagttcgccaccgcgctcgagcagcacgtgaagcaatac
gacgtcgacatcatggacgtgcagcgcgccgacgcgctgattccgggcgacgtgcaccag
atccgcctcgcgaacggcgcggtgctgaaggcgaagacgatcatcctggcgaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgaataccgcaaccgcggtgtcgcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtggtcggcggcggc
aattcgggcgtcgaggccgcgatcgacctggccggcatcgtgaaggaagtcacgctgctc
gaatacggcgcgcaactgcgcgcggacgaggtgctgcaacgcaagctgcgcagcctgccg
aacgtgacgatcgtcacgcaggcacagacgaccgagctgaccggcgacggcagcaagctg
aacgggctcgtctacaaggatttgcgttcgggtgaagcgaagcgcgtcgatctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgaatggctgaagggcacgatcgagctg
tcgaagcacggcgagatcgtcgtcgatgcacgcggcgcgacgtcggtgcccggcgtgttc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcctcgctcggcgcgttcgaccacctgatccggcaggacgtgacgccggccacg
gccgacacgccgcaggccgaagaagcgatcgccgcgtaa

DBGET integrated database retrieval system