KEGG   Burkholderia ambifaria AMMD: Bamb_3535Help
Entry
Bamb_3535         CDS       T00398                                 

Definition
(GenBank) 2,3-dimethylmalate lyase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00440  Phosphonate and phosphinate metabolism
bam01100  Metabolic pathways
bam01120  Microbial metabolism in diverse environments
bam01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bamb_3535
Enzymes [BR:bam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Bamb_3535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: ABI89089
UniProt: Q0B9T4
LinkDB All DBs
Position
2:complement(354316..356001)
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFSESRSARLRRMLVSNELEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQSDSDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIHENETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNVR
GAGVDRLKAMLATLQARPDFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPSTGNGGAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcgcgaacccaacttctccgaatcgcgcagcgcacgcctgcgccgcatgctc
gtcagcaacgaactcgaattcctgatggaagcgcacaacggcctgtccgcacggatcgtc
cgcgaagcaggcttcaaggggatctgggcatcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacgcaggtcgtcgacgtgctcgagttcatggct
gacgcaagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggat
aaacaattcccgaagacgaacagcttcatcggcggcgaacgccagccgctcgcggaaatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgactccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgcggaagccggtgcggacgcgatcctgatccacagcaagctgtcgcgc
ccggacgaaattctccagttcgcacgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcatcggcatcggcgatgcaggccgtcgcacgcgag
attcatgaaaacgagacgctgatcaacgtcgaggaccgcgtcgcgtccgtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggcagccgagcgtatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgccgcgatcgtgctcgccgcgagccgcggcaagggactcgaggcc
gtgaccgaagataagcccaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagacgcacggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgacacgtcgggcatcaagctcgtcgtcaacgagcgtcacgcgcagacg
ggcgagctcgcatcgctcgcgtgcgcggccgaacgtctgaccggcgacaccgtgatctcg
tacggtgacctgctgttccgcagctacatcgtgcgcgacctcgcggagagcgaggccgag
ttcagcgtcgtcgtcgactcgtcgctcacggagaccaaccagagcgtgcgcgatttcgcg
ctttgctcggccgccgacgaccgcggcctgttcggccagaaaacctacctgcaacgcgta
tcgagcgacgtcgccgcaggcacgccgcacggccgctggatcggtctgttgaacgtgcgc
ggcgcaggcgtcgaccgcctgaaggcgatgctcgcgacgctgcaggcacgtcctgatttc
gacacgctcgatatcccgtcgctgctcaacgaactgatcgccgccggcgagaagatcgag
gtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaagacttccgccgcgcg
ggcgacttcgcgcacggccagacgccgctgtccgagccgagcaccggcaacgggggcgcg
caatga

DBGET integrated database retrieval system