KEGG   Burkholderia ambifaria AMMD: Bamb_4711Help
Entry
Bamb_4711         CDS       T00398                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00250  Alanine, aspartate and glutamate metabolism
bam00410  beta-Alanine metabolism
bam00640  Propanoate metabolism
bam00650  Butanoate metabolism
bam01100  Metabolic pathways
bam01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Bamb_4711
   00650 Butanoate metabolism
    Bamb_4711
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bamb_4711
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bamb_4711
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bam01007]
    Bamb_4711
Enzymes [BR:bam01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Bamb_4711
Amino acid related enzymes [BR:bam01007]
 Aminotransferase (transaminase)
  Class III
   Bamb_4711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABI90261
UniProt: Q0B6G2
LinkDB All DBs
Position
2:1700141..1701481
Genome map
AA seq 446 aa AA seqDB search
MGCQRGRFLSHRTDIKEMTVKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRR
FIDFAAGIAVLNTGHRHPKIVKAITEQLNSFTHTAYQIVPYASYVELAEKINGRAPGDFP
KKTAFFTTGAEAVENAIKIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPF
PGDVFHAPYPNALHGVSTADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFYPAPAEFV
RALRKICNEHGILLIADEVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGR
ADVMDAAAPGGLGGTYAGNPLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNSLQADV
PQIADVRGPGAMVAVEFLKPGSGEPDADFTKRVQARALERGLLLLVCGVYSNVVRFLFPL
TIPQAVFDEALVILEEVLKETVGVPA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgggctgccaacgcggccgatttttatcccaccggacagacatcaaggagatgaccgtg
aagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtcggcgtgatg
tgtgatttctacgcagcccgcgccgagaatgcggagctgtgggatgtcgaaggccgccgc
ttcatcgatttcgccgccggcatcgcggtgctgaacacgggccatcgccacccgaagatc
gtcaaggcgatcacggagcaactgaatagcttcacgcacaccgcttaccagatcgtcccg
tacgcgtcgtacgtcgagctggccgagaagatcaacggacgcgcgccgggcgacttcccg
aaaaagacggccttcttcacgaccggcgccgaagccgtcgaaaacgcgatcaagatcgca
cgcgccgcgaccggccgtccgggtgtcatcgcgttctcgggcggcttccacggccgcacg
atgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttcggcccgttc
ccgggcgacgtgttccacgccccgtacccgaacgcgctgcacggcgtgagcacggccgac
tcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgtcgccgcg
atcatcttcgaaccggtccagggcgaaggcggcttctacccggcgccggccgagttcgtg
cgcgcgctgcgcaagatctgtaacgaacacggcatcctgctgatcgccgacgaagtgcaa
acgggcttcgcccgcaccggcaagctgttcgcgatgcagcactacgacgtgctggccgac
ctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtcgtcggccgt
gccgacgtgatggacgcggcggctcccggcggcctcggcggcacctacgcgggcaacccg
ctggcggtcgcatcggcgcacgcggtgctcgagatcatcgacgaagagaaactgtgcgag
cgcgcgacgcaactcggcgacgtgctgaaggcgaagctgaattcgctgcaggccgacgtg
ccgcagatcgccgatgtgcgcggcccgggcgcgatggtcgcggtcgagttcctgaagccg
ggttcgggcgagccggacgccgacttcacgaagcgcgtgcaggcgcgtgcgctcgagcgc
gggctgctgctgctcgtatgcggcgtgtactcgaacgtcgtgcgcttcctgttcccgctg
acgattccgcaggccgtgttcgacgaagcgctcgtgatcctcgaggaagtgctgaaggag
acggtcggcgtgccggcctga

DBGET integrated database retrieval system