KEGG   Burkholderia ambifaria AMMD: Bamb_5003Help
Entry
Bamb_5003         CDS       T00398                                 

Definition
(GenBank) Cupin 2, conserved barrel domain protein
Organism
bam  Burkholderia ambifaria AMMD
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ABI90552
UniProt: Q0B5M1
LinkDB All DBs
Position
2:complement(2023838..2024371)
Genome map
AA seq 177 aa AA seqDB search
MVDKAVSEFWQNIAPIANPFKPDALPEAYIPNAASDDERLYVPFTETVSSRPLWISPSQN
KWCDILMAKEAGLVNRHYHPHEVFAYTLSGKWGYLEHEWTATRGDFVYETPGEGHTLVAF
DHPEPMRAFFIVKGPLIWLDDEGNPDGYFDVHSYIAMCKAHYEKVGLGAQAIEKLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacaaagccgtatccgaattctggcaaaacatcgcgccgattgccaatccgttc
aagcccgatgcgctgccggaagcttacatcccgaacgcggccagcgacgacgagcgcctt
tacgttccgttcaccgaaacggtttcatcgcggccgctatggatctcgccgtcgcagaac
aagtggtgcgacatcctgatggcgaaggaagccgggctcgtgaaccgccactatcacccg
cacgaggtgttcgcgtacacgctgtcgggcaagtggggatacctggagcacgaatggacc
gcgacgcgcggcgatttcgtgtatgaaacgcccggcgaaggccatacgctcgtcgcgttc
gatcatccggagccgatgcgcgcgttcttcatcgtcaagggcccgctgatctggctcgac
gacgaaggcaaccccgacggctacttcgacgtgcattcgtacatcgcgatgtgcaaggcc
cattacgagaaggtcggcctcggcgcgcaagcgatcgagaagctgtttcgctga

DBGET integrated database retrieval system