KEGG   Burkholderia ambifaria AMMD: Bamb_5591Help
Entry
Bamb_5591         CDS       T00398                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00500  Starch and sucrose metabolism
bam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bamb_5591
Enzymes [BR:bam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Bamb_5591
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Bamb_5591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ABI91138
UniProt: Q0B3Y5
LinkDB All DBs
Position
3:20229..23642
Genome map
AA seq 1137 aa AA seqDB search
MMKREDPLDDVRRAQFPSLAPAGTPRRRRSRRRAPALCADDPLWYKDAIIYQVHVKSFYD
SNNDGIGDFPGLIMKLDYIAELGVDTIWLLPFYPSPRRDDGYDIADYRDVHPDYGTLADV
RRFIREAHARGIRVITELVINHTSDQHPWFQRARRAKPGSMHRDYYVWSDTDTKYAGTRI
IFLDTETSNWTHDPIAGQYYWHRFYSHQPDLNFDNPAVVREVIQVMRFWLDLGIDGLRLD
AVPYLVEREGTNNENLPETHAILKRIRATIDAEYPNRMLLAEANQWPEDVQEYFGEENEC
HMAFHFPLMPRIYMSIASEDRFPIIDIMRQTPALAPSNQWAVFLRNHDELTLEMVTDSER
DLLWQTYASDRRARINLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGD
NIHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMGALYGYDAVNVEAQTRDPHSLL
NWTRRILSTRRATQSFGRGTIRFLRPDNRKVLAYLRELEGHETVLCVANLSRASQAVELD
LSEFAGRVPIEMTSDSAFPPIGQLTYLLTFPPYGFLWFVLSEHGREPSWRQPHAEPLPEY
VTIVMRRGDARPDVGQLHTLAHDALASWLTRRRWFASKDRKIGDAWLNVVTPMPDEPFQY
AEAWVSASDGGVERYVVPLATAWGGETSHPLFTQLALARVRRGHTVGYLTDAFALPAFAR
GMLRKLRDGATVPTSDGGRLDFLPEHALAGLDPGDEAEVRWLAAEQSNSSLVIGDAIVLK
LVRKVAHGVHPEAEMSRHLTRIGYANTATLAGEVVHVDPDGTPHTVAILQRYVDNQGDAW
TRSFDFLRRAIDELALPAAGDGDAAEVDDEPDALLGYAAFAGIIGTRLGQLHVALAQPSD
DPAFAPEAATPEHVDGWCVDAIASFERALDVLRTQLDKLDPVNRAAADTLLASRDAAVQA
IGELVPRTLDAQCTRVHGDFHLGQVLDVQGDALLIDFEGEPARALDRRRAKSHPLRDVAG
LLRSLSYVSATAQFAIEKAPPQTAGRKRALFDRFGQAAADRFVECYRAAADQAPERFVDP
RYADRLLALFLIDKASYELCYEAANRPDWLGVPVGGLAALIERLLATDRAPDHGGNR
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacgcgaagatcccctcgacgacgtgcgtcgcgcgcaattcccgtccctcgca
ccggccggcacgccgcgccggcgccgttcacggcgccgcgcgcccgcgctctgcgcggac
gatccgctgtggtacaaggacgcgatcatctaccaggtacacgtgaagtcgttctacgac
tcgaacaacgacgggatcggcgacttcccgggcctgatcatgaagctcgactacatcgcc
gagctcggcgtcgacacgatctggctgctgccgttctatccgtcgccgcgccgcgacgac
ggctacgacatcgccgactaccgcgacgtgcatcccgactacggcacgctcgccgacgtg
cggcgcttcattcgcgaagcgcacgcgcgcggcatccgcgtgatcaccgagctggtgatc
aaccacacgtcggaccagcatccgtggttccagcgcgcgcggcgcgcgaagcccggctcg
atgcatcgcgactactacgtgtggtccgacaccgacacgaaatacgcgggcacgcggatc
atctttctggataccgaaacatcgaactggacgcacgacccgatcgccggccagtactac
tggcaccgcttctactcgcaccagccggacctgaacttcgacaacccggccgtcgtgcgc
gaggtgatccaggtgatgcgcttctggctcgatctcggcatcgacgggctgcggctcgac
gcggtgccgtacctggtcgagcgcgaaggcaccaacaacgagaacctgccggaaacgcat
gcgatcctgaagcggatccgcgcgacgatcgacgccgagtatccgaaccggatgctgctc
gcggaagcgaaccagtggccggaggacgtgcaggaatacttcggcgaggagaacgaatgc
cacatggcgttccactttccgctgatgccgcgcatctacatgtcgatcgcgagcgaggac
cgcttcccgatcatcgacatcatgcggcagacgccggcgctcgcgccaagcaatcagtgg
gccgtgttcctgcgcaatcacgacgagctgacgctcgagatggtgaccgactcggagcgc
gacctgctgtggcagacctacgcgagcgatcgccgcgcgcggatcaacctcgggatccgg
cgccgcctcgcgccgctgatggaacgcgaccggcgccgcatcgagctgatcaactcgctt
ctgctgtcgatgcccggcacgccggtgatctactacggcgacgaactcggcatgggcgac
aacatccacctcggcgaccgcgacggcgtgcgcacgccgatgcaatggtcgtccgaccgc
aacggcggtttctcgcgcgcggacccggaactgctggtgctgccgcccgtgatgggcgcg
ctgtacggctatgacgcggtcaacgtcgaggcgcagacgcgcgacccgcattcgctgctg
aactggacccgccggatcctgtcgacgcgccgcgcgacgcagtcgttcggccgcggcacg
atccgcttcctgcgtccggacaaccgcaaggtgctcgcgtatctgcgcgaactcgaaggc
cacgagacagtgctgtgcgtcgcgaacctgtcgcgcgcgtcgcaggcggtcgagctcgac
ctgtccgaattcgcgggccgcgtgccgatcgagatgacgtcggactcggcgtttccgccg
atcgggcagctcacgtacctgctgacctttccgccgtacgggttcctgtggttcgtgcta
tccgagcacggccgcgagccgtcgtggcgacagccgcacgcggagccgctgcccgaatac
gtgacgatcgtgatgcggcgcggcgacgcgcgacccgacgtcgggcaactgcacacgctc
gcgcacgatgcgctcgcgtcgtggctcacgcggcggcgctggtttgcatcgaaggaccgc
aagatcggcgacgcatggctgaacgtcgtcacgccgatgccggacgaaccgttccagtac
gcggaggcttgggtgtccgcgagcgacggcggcgtcgagcgctatgtcgtgccgcttgcc
accgcgtggggcggcgagacctcgcatccgctgttcacgcagctcgcgctcgcccgcgtg
cggcgcggccatacggtcggctacctgaccgacgcgttcgcgctgccggcattcgcgcgc
gggatgctgcgcaagctgcgcgacggcgcgacggtgccgacgtccgacggcggccggctc
gacttcctgcccgagcacgcgctggccggcctcgatcccggcgatgaggccgaagtgcgc
tggctcgcggccgagcagagcaacagctcgctcgtgatcggcgacgcgatcgtgctgaag
ctggtgcgcaaggtcgcgcacggcgttcatccggaagcggagatgagccggcacctgacg
cgaatcggctatgcgaacaccgcgacgctcgcgggcgaagtcgtgcacgtcgatccggac
ggcacgccgcatacggtcgcgatcctgcagcgctacgtcgacaaccagggcgacgcgtgg
acgcgttcgttcgacttcctgcggcgcgcgatcgacgagctcgcgctgccggccgcgggc
gacggcgacgcggccgaagtcgacgacgaacccgatgcgctgctcggctacgcggcgttc
gcaggcatcatcggcacgcggctcggccagttgcacgtcgcgctcgcgcaaccgtccgac
gatcccgcgttcgcgcccgaagccgcgacgcccgagcacgtcgacggctggtgcgtggat
gcgatcgcgtcgttcgagcgcgcgctcgacgtgctgcgcacgcagctcgacaagctcgat
ccggtcaaccgcgcggcggcggacacgctgctcgcgtcgcgcgacgcggccgtgcaggcc
atcggcgaactcgtgccgcgcacgctcgatgcgcaatgcacgcgcgttcacggcgatttc
catctcggccaggtgctcgacgtgcaaggcgacgcgctgctgatcgacttcgaaggcgag
ccggcgcgcgcgctcgaccggcgccgcgcgaaatcgcatccgctgcgcgacgtggccggc
ctgctgcgttcgctgtcgtacgtgagcgccaccgcgcagttcgcgatcgagaaggcgccg
ccgcagacggccggccgcaagcgcgcgctgttcgaccgcttcggacaggccgccgccgac
cgcttcgtcgaatgctatcgcgcggccgccgatcaggcgcccgagcgcttcgtcgacccg
cgttacgcggaccgcctgctcgcgctgttcctgatcgacaaggcgtcgtacgagctgtgc
tacgaagccgcgaaccgcccggactggctcggcgtgccggtcggcggactcgccgcgctg
atcgaacgcctgctcgcgaccgaccgcgcgcccgaccacggaggcaaccgatga

DBGET integrated database retrieval system