KEGG   Bacillus velezensis UCMB5033: RBAU_0076Help
Entry
RBAU_0076         CDS       T02795                                 

Gene name
hslO
Definition
(GenBank) disulfide bond chaperone (heat shock protein HSP33)
  KO
K04083  molecular chaperone Hsp33
Organism
bama  Bacillus velezensis UCMB5033
Brite
KEGG Orthology (KO) [BR:bama00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bama03110]
    RBAU_0076 (hslO)
Chaperones and folding catalysts [BR:bama03110]
 Heat shock proteins
  HSP33
   RBAU_0076 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: CDG28061
UniProt: S6FB46
LinkDB All DBs
Position
80510..81385
Genome map
AA seq 291 aa AA seqDB search
MDYLIKAIAYDGKVRAYAARTTDMVNEAQRRHDTWPTASAAIGRTMTASLMLGAMLKGED
KLTVKIEGGGPIGAIVADANAKGEVRAYVSNPHVHFDLNEQGKLDVRRAVGTDGTLSVVK
DLGLRDYFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLL
PGTDEETISTIEKQLSQIEPISKLIQKGLTPEEILEEVLGQKPDVLETMPVKFHCSCSKD
RFETAILGLGKKEIQDMIEEDGKAEAVCHFCNEKYLFTKEELEELRDETTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttaattaaagcaattgcatatgacggtaaagtgcgggcttatgcagccaga
acgacagatatggttaatgaagcgcaaagaaggcatgacacgtggccgacggcatcagcc
gcaatcggccggacgatgacagcttctctgatgctaggagcgatgcttaagggtgaagat
aagctgacagtcaaaatagaaggcggcggcccgatcggagccattgtcgcagatgcgaac
gcaaagggtgaggtaagagcatacgtatcaaacccgcacgttcattttgatctcaatgaa
caagggaaactggatgtcagacgggcggtcggaactgacggaacactcagtgtcgtaaaa
gatttgggcttacgtgattattttacgggacaagtagagattgtctcgggtgaactcggt
gacgacttcacatattatcttgtttcttctgaacaagtcccttcatctgtcggcgtaggt
gttctagtaaatcctgataacaccattctcgctgcgggcgggttcatcattcagcttctt
ccggggactgatgaagaaaccatttcaacaattgaaaagcaattatctcaaatcgaacca
atttcaaaattgattcaaaaaggcctgacaccggaagaaatcttagaagaagttctaggt
caaaaaccggacgttctcgaaacaatgccggtcaaatttcactgttcttgttcaaaagat
cgattcgaaacggccattttaggactaggcaaaaaagaaatacaagatatgatagaagaa
gacggaaaagccgaagcggtttgccatttttgtaatgagaaatatttatttacaaaagaa
gaactggaagagcttcgtgacgaaacaacccgctag

DBGET integrated database retrieval system