KEGG   Bacillus velezensis UCMB5033: RBAU_0472Help
Entry
RBAU_0472         CDS       T02795                                 

Gene name
alrA
Definition
(GenBank) D-alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bama  Bacillus velezensis UCMB5033
Pathway
bama00473  D-Alanine metabolism
bama01100  Metabolic pathways
bama01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bama00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RBAU_0472 (alrA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    RBAU_0472 (alrA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bama01011]
    RBAU_0472 (alrA)
Enzymes [BR:bama01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RBAU_0472 (alrA)
Peptidoglycan biosynthesis and degradation proteins [BR:bama01011]
 Precursor biosynthesis
  Racemase
   RBAU_0472 (alrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Big_11
Motif
Other DBs
NCBI-ProteinID: CDG28447
UniProt: S6FW87
LinkDB All DBs
Position
521978..523147
Genome map
AA seq 389 aa AA seqDB search
MTTASFYRETWAEINLSAIKENVTHMKKHIGQNVHLMAVVKANAYGHGDLEVGKAALEAG
ASCLAVAILDEAISLRKRGITAPILVLGAVPPEYVQAAAEYDVTLTGYSVEWLQEAARHL
GSATVPFHLKVDTGMNRLGVKTEEEIQSVLKILSQNPGLVCKGVFTHFATADEKNRDYFL
FQFDRFKTLIAPLPLKELMVHCANSAAGLRLKKGFFNAVRFGISMYGLRPSADIQSEIPF
QLKPAFALHSVLSHVKKIRKGESVSYGATYTAEKDQWIGTVPIGYADGWLRKLSGTSVLI
GGKRMNIAGRICMDQLMVELDQSYPPGTKVTLIGSQKEETITMDEIAGRLETINYEVPCT
ISSRVPRMFLENESIMEVRNPLLQDNTNK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagcatccttttacagagaaacgtgggcggaaatcaatctgtccgcgattaaa
gaaaatgtcacgcatatgaaaaaacacatcgggcaaaacgtccatctcatggcggttgta
aaggcgaacgcttacggacacggagatttggaagttgggaaagccgcgcttgaagcgggt
gcctcttgtcttgccgtagccatactggatgaagcgatttcattgagaaagcggggcatt
acagcgccgattctcgtgcttggcgccgtgccgcccgaatatgtacaagcagctgccgag
tatgacgtaacactcacggggtattctgttgaatggcttcaggaagctgcgcgccacctc
ggaagtgcgacagtgccgtttcatctgaaagtcgacaccggcatgaacagactcggagtc
aaaacggaggaagaaatccaaagcgtgttaaaaatcctcagccaaaatcccggtttagtc
tgtaaaggcgtattcacccattttgctaccgcggatgagaaaaacagagattatttcctc
ttccagtttgaccgctttaaaacattgatcgctccgctccctttaaaagaattgatggtg
cactgcgcgaacagcgctgccggacttcgtcttaaaaaaggcttctttaacgcggttcgt
ttcggcatcagtatgtacgggcttcgtccttctgctgacatccaaagcgaaattccgttt
caattaaagccggcttttgcgctgcactctgttttatcccatgtgaaaaagatccgcaaa
ggggaaagcgtcagctacggcgcaacatatacggcagagaaggatcaatggatcggaacg
gttcccatcggctatgcggacgggtggctccgcaagctgagcggcacgtctgtgctgatc
ggcggcaaacggatgaatatcgcgggaagaatctgcatggatcaattgatggtcgaatta
gatcaatcttatccgccgggcaccaaagtcaccctgatcggcagccagaaggaagaaacg
atcacgatggatgaaatcgccgggcggcttgagacgattaattacgaggtcccttgtacc
attagttcccgcgttccccgtatgtttttggaaaatgagagtataatggaagtaagaaat
cctttactgcaagataatacaaacaagtag

DBGET integrated database retrieval system