KEGG   Bacillus velezensis UCMB5033: RBAU_0651Help
Entry
RBAU_0651         CDS       T02795                                 

Gene name
yeaD
Definition
(GenBank) conserved exported protein of unknown function
Organism
bama  Bacillus velezensis UCMB5033
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF58 DUF11
Motif
Other DBs
NCBI-ProteinID: CDG28624
UniProt: S6FHL2
LinkDB All DBs
Position
683182..684366
Genome map
AA seq 394 aa AA seqDB search
MRRKMHWLLYGWKLLMLAVLTAAVFSYAMFQGGFVSWFLFYAFLPFTVYAGLVAVYPLRA
FQVTRDVSSAQLTSGDRLSVTIRLTRRLPFPLTYMVIEDVMPETLGERRSAKQLVFPWFQ
RKLTLQYELPQVPRGEHHLHTIRVRTGDVLGLLDKTASFSVMDTVLVFPAYGSVHYKPQA
ASGEEGAAAGAPFQVHRSAMAASVRNYQPGDRFSALDWKTSARRNELMTKEFDPLQSVNM
ILLLDCRPSPSFEAAVSASASLLYTALVKGSPAGFISLGSDRTVFPVREGDRHFRKMLRY
LASASESEEADAGGRLGKELAEPRVRKASIAVVTGSLTEDLLKQAEPGRADMTVFLAKET
NAALSEKERKLALIFAQKNIKVQMIRDKRVSHVV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggaagatgcattggcttctatatggctggaagctgcttatgttggccgtactg
acggcggctgtcttttcttatgccatgtttcagggcggatttgtgagctggtttttattt
tatgcgtttttgccgtttaccgtttacgccgggctggtcgctgtgtacccgctgcgggcg
tttcaggtgacgcgtgacgtgtcctccgcccagttaacctcaggcgacaggctgtctgtc
accatcaggctgacgaggcgcctgccgtttccgctgacatatatggtcattgaagatgtg
atgccggaaacgcttggcgagaggcgcagtgcgaaacagctcgtgtttccgtggtttcaa
aggaagctgacgttacaatatgagctgccgcaggtgccgcgcggagagcatcatttacat
acgataagagtgcggacgggagatgttctcgggcttttggacaagacggcgtcgttttcc
gttatggatacggttctggttttcccggcgtacgggtctgttcactataagccgcaggcc
gcatccggagaagagggtgcggctgccggcgctccgtttcaggtacaccgctccgcaatg
gctgcgagcgtcagaaattatcagccgggcgaccggttttccgcacttgactggaaaaca
tcggcgcggcgaaatgagctgatgacgaaggaatttgacccgctgcagagtgtgaatatg
attctccttttggactgcaggccgtccccatcgtttgaagccgcggtatcagcttcggca
tccctgctttacacggcgcttgtgaagggctctcccgcaggatttatttcattggggagc
gaccggaccgtatttcccgtccgggagggagaccggcacttcagaaagatgctgcgttac
ctggcatcagcttcagaatcggaagaagccgatgcaggcgggcgtttaggaaaagagctg
gcggagccgcgcgtccgtaaagcttccattgccgtcgtgacgggcagtcttacagaagac
cttctcaaacaggctgagcccggccgtgctgacatgacggtgtttttggcgaaagaaacg
aatgccgcgctttctgagaaagaacggaaactcgctctcatcttcgctcaaaaaaatatt
aaggtgcaaatgatcagggacaaacgggtgtcccatgttgtttag

DBGET integrated database retrieval system