KEGG   Bacillus velezensis UCMB5033: RBAU_2687Help
Entry
RBAU_2687         CDS       T02795                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase (iron-sulfur protein)
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bama  Bacillus velezensis UCMB5033
Pathway
bama00020  Citrate cycle (TCA cycle)
bama00190  Oxidative phosphorylation
bama00650  Butanoate metabolism
bama01100  Metabolic pathways
bama01110  Biosynthesis of secondary metabolites
bama01120  Microbial metabolism in diverse environments
bama01130  Biosynthesis of antibiotics
bama01200  Carbon metabolism
Module
bama_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bama_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bama00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RBAU_2687 (sdhB)
   00650 Butanoate metabolism
    RBAU_2687 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RBAU_2687 (sdhB)
Enzymes [BR:bama01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RBAU_2687 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     RBAU_2687 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_18 Fer4_2 Fer4 Fer4_16 Fer4_15 Fer4_4 Fer4_13 Fer4_21 Fer4_3
Motif
Other DBs
NCBI-ProteinID: CDG30655
UniProt: S6FTU9
LinkDB All DBs
Position
complement(2826055..2826813)
Genome map
AA seq 252 aa AA seqDB search
MSEKKIRFIITRQDTPESAPYDEEFEINYRPNLNVISALMEIRRNPVNAKGEKTTPVAWD
MNCLEEVCGACSMVINGRPRQSCTALIDKLEQPIRLKPMKTFPVVRDLQVDRSRMFDSLK
KVKAWVPIDGTYDLGPGPRMPEKRRQWAYELSKCMTCGVCLEACPNVNSKSKFMGPAPMS
QVRLFNAHPTGAMNKAERLEALMTDGGLGDCGNSQNCVQSCPKGIPLTTSIAALNRDTNL
QAFRNFFGSDRV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaaaaagatacggtttatcattacacgtcaggatacgcccgaaagcgcgcca
tacgatgaagaattcgaaatcaattaccgcccgaacctgaacgtgatttccgccctgatg
gaaatccgcagaaatcccgtgaatgcaaaaggagagaaaaccactccggtcgcatgggac
atgaactgtcttgaagaagtatgcggcgcctgctccatggtcatcaacggaagaccgcgc
cagtcatgtacggcgctgattgataagctggaacagccgatccgtctgaagccgatgaaa
acattcccggttgtccgtgaccttcaggttgaccgcagcagaatgtttgattcactgaaa
aaagtgaaagcatgggtgccgattgacggaacttacgatttggggccggggccgagaatg
ccggaaaaacgccgccagtgggcatatgaattgtctaaatgcatgacatgcggcgtctgc
ctcgaagcctgcccgaacgtcaacagcaagtcgaaattcatggggcctgccccgatgtcg
caagttcgtctgtttaacgcccatccgacgggcgcgatgaacaaagcagaacgtttagaa
gcgttaatgacagacggcggcctcggagattgcgggaattcacaaaactgtgttcaatcc
tgcccgaaaggcattccgcttacgacttcaatcgccgctttgaacagagataccaattta
caagcattccgtaatttcttcggaagcgacagagtataa

DBGET integrated database retrieval system