KEGG   Bacillus velezensis UCMB5033: RBAU_2688Help
Entry
RBAU_2688         CDS       T02795                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase (flavoprotein subunit)
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bama  Bacillus velezensis UCMB5033
Pathway
bama00020  Citrate cycle (TCA cycle)
bama00190  Oxidative phosphorylation
bama00650  Butanoate metabolism
bama01100  Metabolic pathways
bama01110  Biosynthesis of secondary metabolites
bama01120  Microbial metabolism in diverse environments
bama01130  Biosynthesis of antibiotics
bama01200  Carbon metabolism
Module
bama_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bama_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bama00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RBAU_2688 (sdhA)
   00650 Butanoate metabolism
    RBAU_2688 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RBAU_2688 (sdhA)
Enzymes [BR:bama01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RBAU_2688 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     RBAU_2688 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored Not3 DUF844 DAO AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: CDG30656
UniProt: S6FIR5
LinkDB All DBs
Position
complement(2826816..2828576)
Genome map
AA seq 586 aa AA seqDB search
MSQSSIIVVGGGLAGLMATIKAAESGTAVKLFSIVPVKRSHSVCAQGGINGAVNTKGEGD
SPFEHFDDTVYGGDFLANQPPVKAMCEAAPSIIHLLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAYAGATTGQQLLYALDEQVRRYEVAGLVTKYEGWEFLGAVLDDERTCRGIVAQNLT
NMQIESFRSDAVIMATGGPGIVFGKSTNSMINTGSAASIVYQQGAYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPKELDVKLGGIIEIYEKFMGDDPRKLPMKIFPAVHYSMGGLWV
DYDQMTSIRGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAVKYVSGLETSAEDL
PSSLFDSYVKKEEEKWADIMKMDGDENAYVLHRELGEWMTANVTVVRHNDKLLKTDDKIQ
ELMERFKKININDTTKWSNQGAMFTRQFSNMLQLARVITLGAYNRNESRGAHYKPDFPER
NDDEWLKTTMAKHAGPFEAPEFEYQDVDVSLIAPRKRDYSKKKVAK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcaagcattatcgtagtcggcgggggtcttgccggcctcatggcaacaatt
aaagcagcggaatcaggcacggccgttaaattgttttccatcgttccggtcaaacgctct
cactcggtctgcgcgcagggcgggataaacggagctgtcaacacaaaaggggaaggagac
tctccgtttgagcattttgatgacacggtatacggaggcgactttttggcaaaccagcct
cctgtaaaagcgatgtgtgaagcggcgccgtccattatccacttattggaccgcatgggg
gttatgtttaacagaacgccggaagggctcttggacttccgccgtttcgggggtacacag
catcacagaaccgcatacgcgggagcgacgacgggtcagcagcttctttacgcactggac
gagcaggtgcgcagatatgaagtggcgggtctcgtcacaaaatacgaaggctgggaattc
ctcggcgccgttcttgacgatgagcgcacgtgccgcggtatcgtagcccaaaatctgacc
aatatgcaaatcgagtcattccgttctgacgccgttattatggcgacgggaggtcccgga
atcgtattcggcaaatcaacaaacagcatgatcaacacgggatctgccgcatcaatcgtt
tatcagcagggcgcttattatgcaaacggcgaatttatccaaattcacccgacagcaatc
ccgggggacgataaactgcgtctgatgagtgaatcggcgcgcggcgagggcggaagagtc
tggacgtataaagacggaaaaccttggtacttccttgaggaaaaatatccggcttacgga
aacctcgtgccgcgggatattgcgacacgtgaaatctttgacgtgtgcgtgaatcagaaa
ctcggcatcaacggagaaaacatggtgtatctcgatctgtcgcacaaagatccgaaagag
ctcgacgttaagcttggcggcattatcgaaatctatgaaaaattcatgggcgatgacccg
cgcaagcttccgatgaaaattttccctgccgttcactattcaatgggcggactgtgggtt
gattatgatcagatgacaagcatccgcggactgttcgcagcgggggaatgtgattattca
atgcacggaggaaaccgtttaggggcgaactctctgctttccgccatctacggaggaatg
gtggccggaccaaatgcggtgaaatatgtttccggacttgaaacatcagcggaagacctg
ccttcttcattatttgattcctatgtgaaaaaagaagaagaaaaatgggccgatattatg
aagatggacggcgacgaaaatgcctacgtgcttcaccgtgagctcggagaatggatgacg
gccaacgtcacggtggtccgccacaacgacaagcttttgaaaacggatgacaaaatccaa
gagctgatggaacgctttaagaaaatcaatatcaacgatacgacaaaatggagcaaccaa
ggggcgatgttcacccgccagttctccaatatgcttcagcttgccagagtcatcacgctc
ggcgcatataaccgaaatgaaagccggggagcgcactataaaccggatttccctgaaaga
aatgacgatgagtggctcaaaacgacgatggctaaacatgccggtccgtttgaagctccg
gaatttgaatatcaggatgtcgatgtatcactgattgcgccccgtaaacgcgactactcg
aagaagaaggtggcgaaataa

DBGET integrated database retrieval system