KEGG   Bacillus velezensis UCMB5033: RBAU_3125Help
Entry
RBAU_3125         CDS       T02795                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
bama  Bacillus velezensis UCMB5033
Pathway
bama00071  Fatty acid degradation
bama00280  Valine, leucine and isoleucine degradation
bama00281  Geraniol degradation
bama00362  Benzoate degradation
bama00592  alpha-Linolenic acid metabolism
bama01100  Metabolic pathways
bama01110  Biosynthesis of secondary metabolites
bama01120  Microbial metabolism in diverse environments
bama01130  Biosynthesis of antibiotics
bama01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bama00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RBAU_3125 (fadA)
   00592 alpha-Linolenic acid metabolism
    RBAU_3125 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RBAU_3125 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    RBAU_3125 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RBAU_3125 (fadA)
   00642 Ethylbenzene degradation
    RBAU_3125 (fadA)
Enzymes [BR:bama01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     RBAU_3125 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CDG31091
UniProt: S6FJU6
LinkDB All DBs
Position
complement(3261781..3262956)
Genome map
AA seq 391 aa AA seqDB search
MREAVIVAGARTPVGKAKKGSLAAVRPDDLGALCVKETLKRAGGYEGNIDDLIIGCATPE
AEQGLNMARNIGALAGLPHTVPAITVNRYCSSGLQSIAYGAEKIMIGAGDTVIAGGAESM
SQVPMMGHVTRPNIALAEHAPEYYMSMGHTAEQVAETYGVSREDQDAFAVRSHQNAAKAL
KEGKFNDEIVPVEVSLTEVGDDHKPRKKQFTFSQDEGVRPGTSADVLAKLRPAFSKTGTV
TAGNSSQTSDGAAAVMLMDREKASSLGLAPLVKFRSFAVGGVPPEVMGIGPIEAIPRALK
LAGLELQDIGLFELNEAFASQAIQVIRSLGIDEEKVNVNGGAIALGHPLGCTGTKLTLSL
IHEMKRRNEQFGVVTMCIGGGMGAAGVFELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcagtcattgtggccggtgcgagaaccccggtcggtaaagcgaaaaaagga
tcgcttgcagccgttcgtcctgatgatttaggcgcgctttgtgtaaaagaaacgctgaaa
cgggcaggcggctatgaaggaaatatcgatgacttaattatcggatgtgcaacacctgaa
gccgaacaaggattaaatatggcgcggaatatcggtgcgctggcggggcttcctcatacg
gtgccggccattacggtgaaccgctactgctcttccgggctccaatccatcgcttacggt
gctgaaaaaatcatgatcggcgcgggagacaccgttattgcgggcggtgcggaatccatg
tcgcaagttccgatgatgggacatgtgacccgcccgaatatcgctttggcggagcatgcg
cctgagtattacatgagcatggggcacacagcggagcaggtagccgaaacgtacggcgta
tccagagaagaccaggatgcatttgccgtccgcagccatcagaatgccgcaaaagccctt
aaagaagggaaattcaatgacgaaatcgtgccggttgaagtatcgctgacagaagtcggt
gatgaccataagccgcggaaaaaacaatttaccttttctcaagatgaaggcgttcgtccc
ggcacatcggctgatgtcttggcgaagctccgtccggctttttctaaaacgggaaccgtg
acggccgggaactcttcacaaacaagtgacggcgcggcggctgtcatgctgatggatcgc
gaaaaagcttcgtcgctcggattggcgccgcttgtcaaattccgttcctttgccgtaggc
ggcgttccgcctgaggtaatggggatcggtccgattgaagccattccgcgggcgctcaag
cttgccggactcgaattacaggatattgggctttttgaattgaatgaggcctttgcttca
caggccattcaagtcatcagatcgcttgggatagatgaagaaaaggtgaacgtcaacgga
ggcgccatcgcgctcggacatccgctcggatgcacgggaacgaagctgaccctgtcactc
attcatgaaatgaaacggagaaacgagcaattcggcgtggtgacgatgtgcatcggaggc
ggcatgggcgctgccggcgtatttgaactcatttaa

DBGET integrated database retrieval system