KEGG   Bacillus velezensis UCMB5033: RBAU_3626
Entry
RBAU_3626         CDS       T02795                                 

Gene name
bacG
Definition
(GenBank) phenylalanine aminotransferase forming tetrahydrotyrosine in bacilysin synthesis
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bama  Bacillus velezensis UCMB5033
Pathway
bama00998  Biosynthesis of various secondary metabolites - part 2
bama01100  Metabolic pathways
bama01110  Biosynthesis of secondary metabolites
Module
bama_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bama00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    RBAU_3626 (bacG)
Enzymes [BR:bama01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     RBAU_3626 (bacG)
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C
Other DBs
NCBI-ProteinID: CDG31592
UniProt: S6FZU6
LinkDB
Position
complement(3748147..3749346)
AA seq 399 aa
MEIIPSDVIKTLPKQEFSLVFQKVKEMEKTGAQIINLGQGNPDLPTPPHIVETLREAALN
PSYHGYGPFRGYPFLKEAIAEFYEREYGVSVNPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELHEMPLHPENGYLPDFERIDPAVLKKAKLMFLNYPNNPT
GATADQAFYEKAAAFAKKHDIHLIHDFAYGAFEFDQNPASFLQAKEAKTVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAAAAALSGNPEHTERLKRTYKE
RIDFFTVLCEKELGWSIEKSKGTFYVWAEIPNEFESSHQFSDYLLEHAHVVVTPGEIFGS
GGKRYVRISMVAKQGDLREFVLRIQKLGLSFPSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaatcataccgtccgacgtcatcaagacacttccgaaacaggaattttcgctcgtt
tttcaaaaggtaaaagagatggagaaaacgggagcccagatcattaatctcgggcagggg
aatcccgatctccccacaccgccgcatatcgttgaaacattgcgggaggctgcgctgaat
ccttcgtatcacggatacggcccgttcagaggctatccgtttctgaaagaagccatcgcg
gaattttatgagagagagtacggggtatcggtcaatccggagacagaagtcgcgctgttc
ggcggagggaaagctggtttgtacgttttgacgcaatgcctgctgaatcccggcgatatc
gccttagtcccgaaccccggctaccctgagtatttatcgggcattacaatggccagagcg
gagctgcatgagatgccgcttcatccggaaaacggctatctgccggattttgagcggatt
gatcccgccgtcctgaaaaaagccaagctgatgtttttgaattacccgaataacccgacg
ggcgcgactgcggatcaggcgttttatgaaaaagcggcagcgtttgcaaaaaaacatgac
atccaccttattcacgattttgcatacggcgcgttcgaatttgatcagaacccggccagc
tttcttcaggcgaaagaagcgaaaacggtcggcgcggagctttattcattttcgaaaacc
ttcaatatggcaggctggagaatggcatttgccgtggggaatgagaaaatcattcaggcg
gtcaatgagtttcaggatcacgtcttcgtcggcatgttcggcggtcttcagcaggcggca
gcggcggcgctgtcaggaaatcctgagcataccgagcgtctgaagcgcacatataaagaa
cggattgactttttcacggtgttatgtgaaaaggaattaggctggagcattgaaaaatcg
aaagggactttttatgtatgggctgaaattccgaatgaattcgagtcttcacaccagttt
tcggactatctgctggagcatgcccatgttgtcgtgacgcccggcgagattttcggcagc
ggcggaaagcgttatgtcagaatatcaatggtggccaagcagggcgatttgagggaattc
gtgctgcggattcaaaagctcggtttgtcctttccttcattacaagaaacatcccgctga

DBGET integrated database retrieval system