KEGG   Bacillus velezensis UCMB5033: RBAU_3825Help
Entry
RBAU_3825         CDS       T02795                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase (large subunit)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bama  Bacillus velezensis UCMB5033
Brite
KEGG Orthology (KO) [BR:bama00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RBAU_3825 (ahpF)
Enzymes [BR:bama01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RBAU_3825 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored HI0933_like Thi4 DAO AlaDh_PNT_C NAD_binding_7 Glutaredoxin FAD_binding_3 NAD_binding_8 K_oxygenase Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CDG31791
UniProt: S6FLT0
LinkDB All DBs
Position
3956830..3958359
Genome map
AA seq 509 aa AA seqDB search
MVLDANIKAQLNQYMQLIENDIVLKVSAGDDDTSKDMLALVDELASMSSKISVEKTELNR
TPSFSVNRTGEDTGVTFAGVPLGHEFTSLVLALLQVSGRAPKADQKVIDQIKNISGEYRF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAFKEEVESKNIMAVPTVFLNGESF
GSGRMTIEEILAKMGSGADASEFADKEPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER
FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKDYDIDVMNLQRAKRLEKKDLFELELE
NGAVLKSKTVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVHKNAQTKEITGDQNVNGITF
VDRETGEEKHVELQGVFVQIGLVPNTEWLDETVERNRIGEIIVDKSGATSIPGLFAAGDC
TDGPYNQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgatgcaaatatcaaagcacaattaaatcaatacatgcagctaattgagaac
gacattgttctcaaagtaagcgccggtgacgatgacacttctaaggacatgctggctctc
gttgacgagctggcttccatgtcatctaaaatttcagttgaaaaaactgaattaaacaga
acaccgagcttcagcgttaatcgtaccggagaagacacaggcgttacattcgccggtgtt
cctctcggccacgaatttacatcattagtgctggcattgcttcaagtcagcggcagagcg
cctaaggctgatcaaaaggtcattgaccagattaagaacatcagcggagaataccgattc
gagtcttatatcagcctgacgtgccacaactgccctgatgtcgtccaagcattaaacatg
atgagcgtgctcaacccgaatatcactcatacaatgattgacggcgcggcattcaaagaa
gaagtggaaagcaaaaacattatggctgttccgactgtattcttaaacggtgaatctttc
ggaagcggccgtatgaccatcgaagagattctcgcaaaaatgggcagcggcgcagatgcg
tctgagtttgccgacaaagagccgtttgacgttcttgttgtcggcggcggacctgccggc
gcaagcgcggccatctacacggcgcgtaaaggcatccgcaccggtgtcgtcgctgaacgc
ttcggcggccaggtactcgacaccatgagcatcgaaaacttcatcagcgtcaaagcgact
gaaggaccgaagctcgctgcaagccttgaagagcacgtgaaagattatgatattgacgtc
atgaaccttcagcgcgcgaaacgccttgagaaaaaagacctcttcgaacttgaactcgaa
aacggcgctgtactgaaaagtaaaacagtgatcctgtcaacaggtgcccgctggcgcaat
gtcaacgtacctggtgagcaagagttcaaaaacaaaggtgttgcatactgcccgcactgt
gacggaccattgtttgaaggcaaagacgtagcggttatcggcggcggaaactccggaatc
gaagcggcgattgaccttgcaggtatcgttaatcacgtgactgtgctggaattcgcgcct
gaactgaaagcagacgaagtcctgcaaaaacgtctttacagcctgccaaacgtcactgtg
cacaaaaatgcacaaacgaaagaaatcacaggcgaccaaaacgtaaacggcattacgttc
gttgaccgtgaaacaggcgaagaaaaacacgttgaacttcaaggtgtattcgtccaaatc
ggtctcgtgccgaatacagaatggttagacgaaacggtcgaacgcaaccgcatcggcgaa
atcatcgttgataagagcggcgcgacaagcattcccggcctattcgccgcaggggactgc
acagacggcccgtacaaccaaatcattatctccatgggatcaggtgcaactgccgcttta
ggcgcatttgattatttgatccggaattaa

DBGET integrated database retrieval system