KEGG   Bacillus velezensis NAU-B3: BAPNAU_0356
Entry
BAPNAU_0356       CDS       T02859                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00250  Alanine, aspartate and glutamate metabolism
bamb00280  Valine, leucine and isoleucine degradation
bamb00310  Lysine degradation
bamb00410  beta-Alanine metabolism
bamb00640  Propanoate metabolism
bamb00650  Butanoate metabolism
bamb01100  Metabolic pathways
bamb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BAPNAU_0356 (gabT)
   00650 Butanoate metabolism
    BAPNAU_0356 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAPNAU_0356 (gabT)
   00280 Valine, leucine and isoleucine degradation
    BAPNAU_0356 (gabT)
   00310 Lysine degradation
    BAPNAU_0356 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BAPNAU_0356 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bamb01007]
    BAPNAU_0356 (gabT)
Enzymes [BR:bamb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BAPNAU_0356 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BAPNAU_0356 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     BAPNAU_0356 (gabT)
Amino acid related enzymes [BR:bamb01007]
 Aminotransferase (transaminase)
  Class III
   BAPNAU_0356 (gabT)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: CDH94137
LinkDB
Position
407478..408785
AA seq 435 aa
MSRTASTEVTTAQWQQKRDQFVSKGVGNGNRGMAVKGEGALLYDLDGRRFIDFAGAIGTL
NVGHSHPKVVEAVKKQAEDLIHPGFNVMMYPSYIELAEKLCALAPGDHAKKAIFLNSGAE
AVENAVKIARKYTKRQAVVSFTRGFHGRTNMTMSMTSKVKPYKFGFGPFASEVYQAPFPY
YYQKPAGMSDEQYDDFIISAFEDFFISAVAPETVACVVMEPVQGEGGFIIPSKRFVQHVA
AFCKKHGIVFVADEIQTGFARTGTYFAIEHFGAVPDLITVSKSLAAGLPLSGVIGRAEML
DAAAPGELGGTYAGSPLGCAAALAVLDIIEEEGLNQRSEEIGRIIEHQAIEWKKEHACIG
EVRRLGAMAAIEIVKDPDTREPDKAKAAAIAKTANENGLLLLTAGINGNIIRFLTPLVVT
DEQLKEGLSIIEAAL
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgagtcgaacagcatcaacggaagtgacaactgcccagtggcagcaaaaacgggatcaa
ttcgtttccaagggggtcggcaacggaaaccgcggcatggccgtaaaaggggaaggggcg
cttttgtacgatttggacggcagacgattcattgattttgccggagcgatcggaacgctg
aatgtcggccattcccatccgaaagtggtggaggccgtgaagaaacaggcggaggatctg
attcacccgggatttaacgtcatgatgtatccgtcttatattgagctggccgaaaaactt
tgcgcccttgcgccgggagatcatgcgaaaaaagcgatttttctcaattcgggagcggaa
gcggtggaaaacgccgtgaaaatcgccagaaaatatacgaagcgccaggctgtcgtgtca
tttacaagagggttccacggccgcacgaacatgacgatgagcatgacgagcaaggtgaag
ccttataaattcggtttcggcccatttgcctcagaggtgtatcaggcgccgtttccttac
tattatcaaaagccggccggcatgagcgacgagcagtatgacgactttatcatcagcgct
tttgaggatttctttatctccgcagttgcaccggaaaccgtcgcctgtgtcgtaatggag
ccggttcagggagaaggcggcttcatcattccgtcaaaacgtttcgtgcagcacgtcgcc
gctttttgtaaaaaacacggcatcgtttttgtagcggatgagattcagaccggttttgcc
agaacgggaacatattttgcgattgagcatttcggagccgttcctgatttgatcaccgta
tccaaatcacttgcggccggattgccgctgagcggcgtcatcggccgggcggaaatgctt
gatgccgccgcgccgggtgaactcgggggcacatatgcgggaagcccgctcggctgtgcg
gctgcgctcgcggtcttggatattattgaagaagaagggctgaatcagcgttccgaggag
atcggccggatcatcgagcatcaagcgatcgagtggaaaaaagagcatgcctgcatcgga
gaagtgcgcagactcggcgcgatggcggccatcgaaattgtcaaagatccggacacgcgg
gaaccggacaaagcaaaagctgcggcgatcgctaaaacggcgaacgagaacggactgctg
ctgctgacggccggcattaacggcaacattatcagattcctgacgccgcttgtcgtgacg
gatgagcagctcaaagaaggcctttccattatcgaagcagctctgtga

DBGET integrated database retrieval system