KEGG   Bacillus velezensis NAU-B3: BAPNAU_0357
Entry
BAPNAU_0357       CDS       T02859                                 

Gene name
gabD
Definition
(GenBank) succinate-semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00250  Alanine, aspartate and glutamate metabolism
bamb00310  Lysine degradation
bamb00350  Tyrosine metabolism
bamb00650  Butanoate metabolism
bamb00760  Nicotinate and nicotinamide metabolism
bamb01100  Metabolic pathways
bamb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAPNAU_0357 (gabD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAPNAU_0357 (gabD)
   00310 Lysine degradation
    BAPNAU_0357 (gabD)
   00350 Tyrosine metabolism
    BAPNAU_0357 (gabD)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BAPNAU_0357 (gabD)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     BAPNAU_0357 (gabD)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     BAPNAU_0357 (gabD)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     BAPNAU_0357 (gabD)
SSDB
Motif
Pfam: Aldedh Peptidase_M32
Other DBs
NCBI-ProteinID: CDH94138
LinkDB
Position
408891..410279
AA seq 462 aa
MPEQLTVYNPATGEAIESIPQQTAEDVEKAIERSHQAFQSWSKTSAGERASLLRKWYELI
VGNKEELAELITKENGKPYEEAVGEVLYGAGYIEWFAEEAKRIYGRTVPAPTTGKRIVVT
RQAVGPVAAITPWNFPNAMITRKAAPALAAGCTFIIKPAEDTPLSAYALARLAYEAGIPK
DVLQVVIGDGAEIGNVFTSSPKIRKITFTGSTPVGKILMKNSADTVKHMSMELGGHAPLI
VDEDADLDLAVAQTMASKFRNAGQTCVCANRLIVHESVKDEFAKKLSEEAAKLKVGNGLE
KGVNVGPVINKKGFDKIVGQINDAVEKGAKVLTGGTYDQNDEKGCYFVTPTVLSDVDTSM
NIMHEETFGPVAPIVTFSDIDEAIKLANDTPFGLAAYFFTENYRRGIYISEQLEYGIIGW
NDGGPSAVQAPFGGMKESGIGREGGTEGIEPYLETKYMSIGL
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgccagaacaattaacagtgtacaacccggcaacgggagaggcgatcgaaagcatcccc
cagcagacggccgaagatgttgaaaaagcgattgaacgttcacatcaagcgtttcaatca
tggtccaaaacatcagcgggagaacgtgcctcacttttgagaaaatggtatgagctgatt
gttggaaataaagaagaacttgcggaattaattacgaaagaaaacggcaaaccgtacgaa
gaagcggtcggagaagttttatacggcgccggttatattgaatggttcgccgaagaagca
aaacggatttacggcagaaccgtacctgcgccgacaacgggcaaacggattgtcgtcacc
cgtcaggcggtcggcccggtagccgcgatcacgccgtggaatttcccgaatgcgatgatt
acaagaaaagccgcgcccgctttggcggcaggctgtacgttcatcatcaaaccggcggag
gatacgccgctttccgcttacgcccttgcgcgtctcgcatatgaagcgggaattccgaag
gacgtgctgcaagtggtgatcggtgacggagccgaaatcggaaacgtcttcaccagcagc
ccgaaaatccgcaaaattacttttaccggctcaacgcctgtcggcaaaatcctgatgaaa
aacagcgccgacaccgtaaaacatatgtcaatggagcttggcggacatgcgccgctgatc
gtggatgaagacgctgatcttgatctggcggtagcccaaacaatggcctctaaattcaga
aatgccggccaaacctgcgtctgtgcgaaccggctgatcgtacacgaatccgtgaaagac
gagtttgcgaaaaaactgagtgaagaagctgcgaaactcaaagtcggaaacggtcttgaa
aaaggcgtaaacgtcggccctgtcatcaacaaaaaaggcttcgataaaatcgtcggccaa
attaatgacgccgtggaaaaaggcgcaaaagtgctgacgggcggaacgtatgaccaaaac
gatgaaaaaggatgctatttcgtgacgccgaccgtgctttcagatgtagatacatccatg
aacatcatgcatgaagaaacattcggcccggttgcgccgatcgttacgttctcagatatt
gatgaagcgatcaagcttgcgaacgatacgccgttcgggcttgcggcttatttcttcaca
gaaaactaccgccgcggcatctatatttctgaacagcttgaatacggtatcatcggctgg
aatgacggcggtccgtccgcggttcaagcgccgttcggaggaatgaaagaaagcggcatc
ggccgtgaaggcggtacggaaggcattgaaccgtacctggaaaccaaatacatgtctatc
ggactttaa

DBGET integrated database retrieval system