KEGG   Bacillus velezensis NAU-B3: BAPNAU_0441Help
Entry
BAPNAU_0441       CDS       T02859                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00473  D-Alanine metabolism
bamb01100  Metabolic pathways
bamb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BAPNAU_0441 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BAPNAU_0441 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bamb01011]
    BAPNAU_0441 (alr)
Enzymes [BR:bamb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BAPNAU_0441 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bamb01011]
 Precursor biosynthesis
  Racemase
   BAPNAU_0441 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CDH94222
LinkDB All DBs
Position
487323..488492
Genome map
AA seq 389 aa AA seqDB search
MNTASFYRETWAEINLSAIKENVTHMKKHIGQNVHLMAVVKANAYGHGDLEVGKAALEAG
ASCLAVAILDEAISLRKQGITAPILVLGAVPPEYVQAAAEYDVTLTGYSVEWLQEAARHL
GSATVPFHLKVDTGMNRLGVKTEEEIQSVLKILGQNPGLVCKGVFTHFATADEKNRDYFL
FQFDRFKELIAPLPLKELMVHCANSAAGLRLKKGFFNAVRFGISMYGLRPSADIQSEIPF
QLKPAFALHSVLSHVKKIRKGESVGYGATYTAEKDQWIGTVPIGYADGWLRKLSGTSVLI
GGKRMNIAGRICMDQLMVELDQSYPPGTKVTLIGSQKGETITMDEIAGRLGTINYEVPCT
ISSRVPRMFLENESIMEVRNPLLQDNTSK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagcatccttttacagagaaacgtgggcggaaatcaacctgtccgcgattaaa
gaaaatgtcacgcatatgaaaaaacacatcgggcaaaacgtccatctcatggcggttgta
aaggcgaacgcttacggccacggagatttggaagttgggaaagccgcgcttgaagcgggt
gcctcttgtcttgccgtagccatactcgatgaagcgatttcattgagaaagcagggcatt
acggcgccgattctcgtgcttggcgccgtgccgcccgaatatgtacaagcagctgccgag
tatgacgtaacactcacgggatattctgttgaatggcttcaggaagccgcgcgccacctc
ggaagtgcaacagtgccgttccacctgaaagtcgacaccggcatgaacagactcggagtc
aaaacggaggaagaaatccaaagcgtgttaaaaatcctcggtcaaaatcccggtttagtc
tgtaaaggcgtattcacccattttgctaccgcggatgagaaaaacagagattatttcctc
ttccagtttgaccgctttaaagaattgatcgctccgcttcctttaaaagaattgatggtg
cactgcgcgaacagcgctgccggacttcgtcttaaaaaaggcttttttaacgcggttcgt
ttcggcatcagtatgtacgggctccgtccttctgctgacatccaaagcgaaattcctttt
caattgaagccggcttttgcgctgcactctgttttatcccatgtgaaaaagatccgcaaa
ggggaaagcgtcggctacggcgcaacatatacggcagagaaggatcaatggatcggaacg
gttcccatcggctatgcagacgggtggctccgcaagctgagcggcacgtctgtgctgatc
ggcggcaaacggatgaacatcgcgggaagaatctgcatggatcaattgatggtcgaatta
gatcaatcttatccgccgggcaccaaagtcaccctgatcggcagccagaagggagaaacg
atcacgatggatgaaatcgcagggcggcttgggacgattaattacgaggtcccttgtacc
attagttcccgcgttccccgtatgtttttggaaaatgagagtataatggaagtaagaaat
cctttactgcaagataatacaagcaagtag

DBGET integrated database retrieval system