KEGG   Bacillus velezensis NAU-B3: BAPNAU_0535
Entry
BAPNAU_0535       CDS       T02859                                 

Gene name
ycsA
Definition
(GenBank) tartrate dehydrogenase
  KO
K07246  tartrate dehydrogenase/decarboxylase / D-malate dehydrogenase [EC:1.1.1.93 4.1.1.73 1.1.1.83]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00630  Glyoxylate and dicarboxylate metabolism
bamb00650  Butanoate metabolism
bamb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BAPNAU_0535 (ycsA)
   00650 Butanoate metabolism
    BAPNAU_0535 (ycsA)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.83  D-malate dehydrogenase (decarboxylating)
     BAPNAU_0535 (ycsA)
    1.1.1.93  tartrate dehydrogenase
     BAPNAU_0535 (ycsA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.73  tartrate decarboxylase
     BAPNAU_0535 (ycsA)
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-ProteinID: CDH94316
LinkDB
Position
complement(576974..578032)
AA seq 352 aa
MKTYKIASIPGDGVGKETVPQAERVLNAIAELHGGIAFDFTSFPWSCEYYLEHGTMMPDD
GLETLQHFDALFLGAVGNQKLVPDHVSLWGLLIKIRREFEQVINVRPAKLLPGITSPLVN
PKDFDLIVVRENSEGEYSSVGGRIYQGEDEIAIQNAVFSRRGTERVMRYAFELAASRRKH
VTSATKSNGIVHSMPFWDDIFKEVSREYAGIETDSQHIDALAAFFVTQPERFDVIVASNL
FGDVLTDIGAAIMGSIGIAPAANINVNGKYPSMFEPVHGSAPDIVGKGIANPIGQIWTAK
LMLDSFGEEELGHLLLQSIETVTNSGILTPDVGGKHSTEDVTSAIISQIKNR
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaaaacttacaagattgccagcataccgggggacggtgtggggaaagaaacagttccg
caagcggagcgggtgttgaacgcgatcgccgaattacatggaggcattgcctttgatttc
acttcttttccgtggagctgcgagtattatttggagcacgggactatgatgccggatgat
ggattagaaacgttacagcactttgatgctttgtttttgggagcggtggggaatcaaaaa
ctcgtccccgatcatgtttcgctgtgggggctgctcatcaagatacgccgggaatttgaa
caggtgattaatgtgcggccggcaaagctcctgccgggaatcacttcccccctcgttaac
ccgaaggattttgatctgatagtcgtccgcgaaaacagtgagggcgagtacagctctgtc
ggcggcagaatctatcagggtgaggacgaaatcgccatacaaaacgcggtcttttcccgc
cggggtacggaaagagtgatgcggtatgctttcgaactggcggcaagtcggcggaaacac
gtcacaagcgcgacgaaatcaaacggtattgttcactcgatgccgttctgggatgacatc
tttaaagaggtcagccgggagtacgccgggattgagacggattcccagcacatcgatgca
ctggcggccttctttgtcacgcagccggaacgctttgatgtcattgtcgcttcgaatttg
ttcggagatgtgctgacagatatcggcgcggcgattatgggaagcatcggaatcgctccc
gcagccaacatcaatgtaaacggcaaatacccttccatgtttgagcctgttcacggctcc
gccccggatattgtcggaaaaggaattgccaatcctataggccaaatatggacggcgaaa
ttaatgcttgattcattcggagaagaggaactgggccatctcctcttacaatctattgaa
acggtcacaaacagcggcattctgactcctgatgtcggcggaaaacattcaacggaagat
gtcacttccgctattatttctcaaatcaagaacagataa

DBGET integrated database retrieval system