KEGG   Bacillus velezensis NAU-B3: BAPNAU_0589Help
Entry
BAPNAU_0589       CDS       T02859                                 

Gene name
cotA
Definition
(GenBank) bilirubin oxidase
  KO
K06324  spore coat protein A, manganese oxidase [EC:1.16.3.3]
Organism
bamb  Bacillus velezensis NAU-B3
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BAPNAU_0589 (cotA)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.3  manganese oxidase
     BAPNAU_0589 (cotA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cu-oxidase_2 Cu-oxidase_3 Cu-oxidase
Motif
Other DBs
NCBI-ProteinID: CDH94370
LinkDB All DBs
Position
complement(635241..636779)
Genome map
AA seq 512 aa AA seqDB search
MALEKFADELPIIETLQPQKKSDGSTYYEVTMKECFHKLHRDLPPTRLWGYNGLFPGPTI
DVNQDENVYIKWMNDLPDKHFLPVDHTIHHSESGHQEPDVKTVVHLHGGATPPDSDGYPE
AWFTKDFKETGPYFEKEVYHYPNKQRGALLWYHDHAMAITRLNVYAGLAGMYIIRERKEK
QLKLPSGEYDVPLMILDRTLNDDGSLSYPSGPANPSETLPDPSIVPFFCGNTILVNGKAW
PYMEVEPRTYRFRILNASNTRTFSLSLNNGGKFIQIGSDGGLLPRSVKTQSISLAPAERY
DVLIDFSAFDGEHIILTNGTGCGGDADPDTDANVMQFRVTKPLKGADTSRKPKYLSTMPN
VTSKRIHNIRTLKLTNTQDKYGRPVLTLNNKRWHDPVTEAPKLGTTEIWSIINPMGGTHP
IHLHLVSFQILDRRPFDLERYNKFGDIVYTGPAVPPPPSEKGWKDTVQAHSGEVIRIAAT
FAPYSGRYVWHCHILEHEDYDMMRPMDVTDKQ
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcactagaaaaatttgcagatgaactgccgattattgaaacactccagccgcagaag
aaatcagacggcagcacgtattatgaagtcacgatgaaggaatgctttcacaagctgcac
cgcgatctcccgccgacccggctgtgggggtataacggtttatttcccggcccgacgatc
gacgtgaaccaagatgagaacgtctatattaaatggatgaatgaccttccggataagcat
tttctgcccgtggatcataccattcaccattcagaaagcggccatcaggaacccgatgtc
aaaaccgtcgtccatttacacggaggagcaacgccgccggacagcgacggctacccggaa
gcatggttcacaaaggattttaaggaaacgggtccttattttgagaaagaggtataccat
tatccaaacaaacagcgcggggctctgttatggtatcacgatcacgccatggcgattacg
aggctcaatgtgtacgccgggcttgccgggatgtatatcatccgcgagcgaaaagaaaag
cagctgaagcttccctccggagagtacgacgtaccgcttatgattttggaccgcacgtta
aatgacgacggttccttgtcttatccgagcggacctgctaacccttccgaaacgctgccc
gacccttccatcgtcccgtttttttgcggaaataccattctcgtcaatggtaaagcgtgg
ccgtatatggaagttgaaccgcggacatatcgtttccgcatccttaatgcctccaataca
agaacattttctctctcgctcaataacggcgggaagtttatccaaatcggttctgacggc
ggactgcttccccgctctgtcaaaacacaatctatcagcttagccccggcagagcggtat
gatgtgctcatcgatttctccgcctttgacggagaacatatcattttaacgaacggcacc
ggctgcgggggcgacgccgatccggatacagacgccaatgtgatgcaattccgcgtcaca
aaaccgctgaagggagcagacacaagccggaagcctaaatatctttcaacaatgcctaat
gtgacatcaaagagaatacacaatatcaggacgcttaaactcacaaatacgcaagacaaa
tacggccggcccgttttgacgctgaataacaagcgatggcatgatcctgtgacagaagcg
ccgaagctcggcacaacggaaatctggtcgattatcaacccgatggggggcacccatccg
atacacctgcaccttgtttccttccaaatccttgaccggcgcccttttgacttagagcgt
tataacaaattcggcgacattgtgtatacaggccccgccgtcccgcctcctccaagtgag
aaaggctggaaagataccgtgcaggcgcactcgggagaggtcatcagaatcgcggcgact
ttcgctccttacagcggacgctacgtatggcactgtcatattttagagcacgaagattac
gacatgatgagaccgatggacgtcacggataagcagtaa

DBGET integrated database retrieval system