KEGG   Bacillus velezensis NAU-B3: BAPNAU_0599Help
Entry
BAPNAU_0599       CDS       T02859                                 

Gene name
aatA
Definition
(GenBank) Aspartate/tyrosine/aromatic aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00220  Arginine biosynthesis
bamb00250  Alanine, aspartate and glutamate metabolism
bamb00270  Cysteine and methionine metabolism
bamb00330  Arginine and proline metabolism
bamb00350  Tyrosine metabolism
bamb00360  Phenylalanine metabolism
bamb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bamb00401  Novobiocin biosynthesis
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01130  Biosynthesis of antibiotics
bamb01210  2-Oxocarboxylic acid metabolism
bamb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAPNAU_0599 (aatA)
   00270 Cysteine and methionine metabolism
    BAPNAU_0599 (aatA)
   00220 Arginine biosynthesis
    BAPNAU_0599 (aatA)
   00330 Arginine and proline metabolism
    BAPNAU_0599 (aatA)
   00350 Tyrosine metabolism
    BAPNAU_0599 (aatA)
   00360 Phenylalanine metabolism
    BAPNAU_0599 (aatA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAPNAU_0599 (aatA)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    BAPNAU_0599 (aatA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bamb01007]
    BAPNAU_0599 (aatA)
Enzymes [BR:bamb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     BAPNAU_0599 (aatA)
Amino acid related enzymes [BR:bamb01007]
 Aminotransferase (transaminase)
  Class I
   BAPNAU_0599 (aatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CDH94380
LinkDB All DBs
Position
649503..650702
Genome map
AA seq 399 aa AA seqDB search
MNKRLSDRVMNIKPSATMSLNAKTKIMVKEGKDIINMSVGEPDLHPPLTASYAGIQAIVK
GKTGYTPAAGLIELRESIVRYLLNERGLEYKPNQIIASAGGKQPLYNVFQAICDQDDEVI
LPSPYWVSYPEQIKLSGAVPVIVSCDETTNFKITPEKLAEVITPKTKAVVITSPNNPTGS
VYSENELKALGNVLKDYSEIFIISDEIYDQFVYEGKHISLPLIFPELLNRTIITNGFSKV
FAMTGWRLGYIAAPSDIAEAIASFQSHATGSPSTISQYAGISALNGFDKSMVEEYKKRRD
ILVDGLNQIEGIQCAKPNGAFYAFPNVSQFFGTMFEDQQIIDAETFCHLLLEKQHVSAVP
GTAFGEPNNIRLNFAIPKDLITEALKRINNFTTQLAVKV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaaagattatccgatagagtcatgaatataaaaccttcggccactatgtcatta
aatgccaaaacgaagataatggtaaaagaaggaaaagacattataaatatgagtgtcgga
gaaccggatcttcatccgccattaacagcctcatatgcaggaattcaggcaatagtgaag
gggaaaaccgggtatacgccggcagcagggctgattgaattaagagaatccattgtgcga
tatctgcttaacgaacgaggtttagaatataaaccaaaccaaataattgcatctgccggg
ggaaaacagccgctatataatgtttttcaagcaatttgtgatcaagacgacgaagttatc
ctcccttcaccttactgggtatcttatccggaacaaatcaaactgtcgggggcggttcct
gttattgtaagctgtgatgaaactacaaattttaaaatcacacccgagaagcttgcagaa
gtaattacccctaagacaaaagctgttgttatcacatctcccaataatccgacagggtcc
gtttattcagaaaatgaactgaaagctttaggaaatgtgttgaaagattattctgaaatt
tttatcatttccgacgaaatttatgatcagtttgtgtatgagggcaagcatatcagtctg
ccgctcatttttcccgaattgctgaatcggaccatcataacgaatggattttccaaagtc
tttgcaatgactggatggaggctcggctatatcgcagccccatcggatatagccgaagcc
attgccagctttcaaagccatgctacaggcagcccgtcaactatttctcaatatgccggt
atttctgctttaaacggttttgacaagtcgatggtcgaagaatacaaaaaaagacgcgat
atattagtcgatggtttaaatcaaattgagggcattcaatgcgccaaaccaaatggagcc
ttttatgcgtttccgaatgtttcacaatttttcggaacaatgtttgaagatcaacaaata
attgatgcggagacattttgtcatcttctgttggaaaaacagcacgtgtcagctgttccc
ggcacagcattcggagagccgaacaacattcgtttgaattttgccatcccaaaggatctt
atcacagaggctttgaaaagaattaataattttacaactcagctggcagttaaggtataa

DBGET integrated database retrieval system