KEGG   Bacillus velezensis NAU-B3: BAPNAU_0763
Entry
BAPNAU_0763       CDS       T02859                                 

Gene name
acoC
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00010  Glycolysis / Gluconeogenesis
bamb00020  Citrate cycle (TCA cycle)
bamb00620  Pyruvate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
Module
bamb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAPNAU_0763 (acoC)
   00020 Citrate cycle (TCA cycle)
    BAPNAU_0763 (acoC)
   00620 Pyruvate metabolism
    BAPNAU_0763 (acoC)
Enzymes [BR:bamb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAPNAU_0763 (acoC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 PYNP_C RnfC_N HlyD_D23 GCV_H EF_TS
Other DBs
NCBI-ProteinID: CDH94544
LinkDB
Position
829359..830552
AA seq 397 aa
MAVKVVMPKLGMAMKKGEVSVWNKKVGDPVEKGESIASINSEKIEMEIEAPESGTLLHIK
VKEGEGVPPGTPICYIGENGEEVREKEAPAPENAGKPQSEPEHMPAPKAGQKRKHRVKIS
PVARKMAEKAGLKVDTLNGTGPGGRIVKADVIKAMKTESEPQSSVQTAQPEGKPASAMRK
VIADRMHKSLQNSAQLTLTMKADITELVKWQQQLADSAKKRSGVKLTITHFVSRAAVLAL
KQHPELNSSYQEERIITYPYVHLGMAVSLENGLVVPVIRDAEKLSFLELADHISTSARRA
REGNASGDDLHGSTFSITNLGGYGIEHFTPILNPPEAGILGVGASYETPAFKGDELVKST
MLPLSLTFDHRVCDGAPAADFLKTVKALLEEPAGLIL
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggctgtaaaagtagtaatgccgaagctgggaatggcgatgaagaaaggtgaagtatcc
gtctggaataaaaaagtcggcgacccggttgaaaagggagaaagcatcgccagcatcaac
tcggaaaaaatagaaatggaaatagaagcgcctgaaagcggcacgcttcttcatattaaa
gtcaaagagggggaaggagtcccgccgggaacgcccatctgttatatcggggaaaacggc
gaagaagtgcgggagaaggaggcgccggctcctgaaaatgcagggaaaccgcaatctgaa
cctgaacatatgcccgctcccaaagccgggcaaaagcgtaaacaccgcgtgaaaatatct
cccgttgcccgaaaaatggcggagaaagccgggttgaaagttgatacgctgaacgggacg
gggcccggaggcagaatcgtaaaagctgacgtcatcaaggccatgaagacggaatctgaa
ccgcagtcttcggttcagacggcacagccggagggaaaaccggcttcagcgatgagaaaa
gtgattgcagaccgaatgcacaaaagcctgcaaaacagcgcccagctgacgctgacgatg
aaagcggacattacggagcttgtgaaatggcagcagcagctcgccgacagcgcgaaaaag
cggagcggtgttaaactgacgatcacacatttcgtatcccgggccgcggtgctcgcgctg
aaacagcatcctgagctgaacagctcttatcaagaggagcggatcatcacctatccatat
gtccacctcgggatggcggtttctcttgaaaacggtctcgtcgtgccggtgatccgggat
gcggaaaagctttcattccttgagcttgcggatcacatcagtacatcggcacgccgggcg
cgggaaggcaatgcttccggagatgacctgcacggatcgacattttctattacaaatctc
gggggttacggaattgagcatttcaccccgattcttaatccgcctgaagccggtattctc
ggagtaggcgcaagctatgaaacgccggcgtttaaaggagatgagcttgttaaaagcacc
atgctgccgctaagtcttacctttgatcacagagtatgtgacggcgcaccggctgcggac
ttcctgaaaacggtcaaagcgctgcttgaagagccggccggattgattttatag

KEGG   Bacillus velezensis NAU-B3: BAPNAU_2309
Entry
BAPNAU_2309       CDS       T02859                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00010  Glycolysis / Gluconeogenesis
bamb00020  Citrate cycle (TCA cycle)
bamb00620  Pyruvate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
Module
bamb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAPNAU_2309 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BAPNAU_2309 (pdhC)
   00620 Pyruvate metabolism
    BAPNAU_2309 (pdhC)
Enzymes [BR:bamb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAPNAU_2309 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3 HlyD_D23 DUF1533
Other DBs
NCBI-ProteinID: CDH96089
LinkDB
Position
complement(2482965..2484293)
AA seq 442 aa
MAFEFKLPDIGEGIHEGEIVKWFVKPNDEVEEDDVLAEVQNDKAVVEIPSPVKGKVLELK
VEEGTVATVGQTIITFDAPGYEDLQFKGSHDSGDAKTEAQVQSSAEAGQDIAKEETPKEP
AKETGAGQQDQAEADPNKRVIAMPSVRKYAREKGVDIRKVTGSGNNGRVVKEDIDSFANG
GAAQEAAPQETAAPQETAKPAAAQAPEGEFPETREKMSGIRKAIAKAMVNSKHTAPHVTL
MDEVDVTNLVAHRKQFKQVAADQGIKLTYLPYAVKALTSALKKFPVLNTSIDDKTDEVIQ
KHYFNIGIAADTEKGLLVPVVKNADRKAVFEISDEINSLATKAREGKLAPAEMKGASCTI
TNIGSAGGQWFTPVINHPEVAILGIGRIAEKAIVRDGEIVAAPVLALSLSFDHRMIDGAT
AQNALNHIKRLLNDPQLILMEA
NT seq 1329 nt   +upstreamnt  +downstreamnt
gtggcatttgaatttaaacttccggatatcggggaaggtatccacgaaggcgaaatcgta
aaatggtttgttaagccgaacgacgaggtagaagaagacgacgttctggctgaagtgcaa
aatgataaagcagtggtagaaattccttcacctgttaaaggaaaagtattagaattaaaa
gttgaagagggaacagttgcaactgttggacaaacgattattacgtttgacgcacctggt
tacgaagatcttcaatttaaaggaagccatgattcaggagatgcgaaaactgaagctcaa
gttcagtcgtctgctgaagcagggcaggatatcgctaaagaagagactcctaaagagcct
gcaaaagaaaccggcgcaggacagcaggaccaagcggaagctgatccgaacaaacgcgtg
atcgcgatgccttccgtacgcaaatatgcccgtgaaaaaggcgtggatatccgtaaagta
acaggttcaggcaataacggacgtgttgtaaaagaagatatcgacagctttgcaaatgga
ggagcggctcaagaagcggcaccgcaagaaacagctgcacctcaggaaacagctaaacct
gcagcggctcaggctcctgaaggcgaattccctgaaacacgcgaaaaaatgagcggtatc
cgtaaagcgatcgcgaaagcaatggtgaactctaagcatactgcaccgcacgtaactctt
atggatgaagttgacgtaacaaatcttgttgctcaccgcaaacagttcaaacaagttgct
gctgatcaaggcatcaagctgacttatctgccttacgccgtcaaagcattaacatccgct
ttgaaaaaattccctgttttaaacacatctattgatgataaaacagatgaagtgatccaa
aaacattacttcaacatcggaattgcagcggataccgaaaaaggcctgcttgtgccggta
gtgaaaaatgccgaccgtaaagccgttttcgaaatctctgatgaaatcaacagccttgct
acaaaagcgcgtgaaggcaagcttgcacctgcggaaatgaaaggcgcttcttgcacgatc
acaaatatcggttctgccggaggccaatggttcacaccggttatcaaccacccagaggtt
gcgattctcggtatcggccgtattgctgaaaaagcgatcgtccgtgacggtgaaattgta
gctgctcctgtcttagctctttctctcagctttgaccaccgtatgattgacggagcaact
gcacaaaatgcgttaaaccacatcaagcgtttactgaacgatccacaacttattttaatg
gaggcgtaa

DBGET integrated database retrieval system