KEGG   Bacillus velezensis NAU-B3: BAPNAU_0764
Entry
BAPNAU_0764       CDS       T02859                                 

Gene name
acoL
Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00010  Glycolysis / Gluconeogenesis
bamb00020  Citrate cycle (TCA cycle)
bamb00260  Glycine, serine and threonine metabolism
bamb00280  Valine, leucine and isoleucine degradation
bamb00310  Lysine degradation
bamb00380  Tryptophan metabolism
bamb00620  Pyruvate metabolism
bamb00630  Glyoxylate and dicarboxylate metabolism
bamb00640  Propanoate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
bamb01240  Biosynthesis of cofactors
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bamb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAPNAU_0764 (acoL)
   00020 Citrate cycle (TCA cycle)
    BAPNAU_0764 (acoL)
   00620 Pyruvate metabolism
    BAPNAU_0764 (acoL)
   00630 Glyoxylate and dicarboxylate metabolism
    BAPNAU_0764 (acoL)
   00640 Propanoate metabolism
    BAPNAU_0764 (acoL)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAPNAU_0764 (acoL)
   00280 Valine, leucine and isoleucine degradation
    BAPNAU_0764 (acoL)
   00310 Lysine degradation
    BAPNAU_0764 (acoL)
   00380 Tryptophan metabolism
    BAPNAU_0764 (acoL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bamb04147]
    BAPNAU_0764 (acoL)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BAPNAU_0764 (acoL)
Exosome [BR:bamb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BAPNAU_0764 (acoL)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA NAD_binding_8 FAD_binding_2 DAO HI0933_like FAD_oxidored AlaDh_PNT_C 3HCDH_N Trp_halogenase Lycopene_cycl FAD_binding_3 NAD_binding_7 TrkA_N 2-Hacid_dh_C UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: CDH94545
LinkDB
Position
830567..831946
AA seq 459 aa
MTLAIIGGGPAGYAAAVTAARRGEEVVLIDKGPLGGTCLNEGCIPTKSLLESANVLDKIR
HANTFGIELPQNITLNWARMQGRKRQIVSRLVQGIQYLMKANQIKVISGTASFLTEQTLL
VEGEGGAKDILEADRILIASGSEPAELPFAPFDGDWVIDSKDALSLQKIPSSLLIVGGGV
IGCEFASLFSRFKTKVTVIESADRLLPAEDGEIAAVFEDSLRDSGADIQTKAALQRIDKE
RKTAVWTKDGKEIEAQADHVLVAIGRKPRLQELNLEQSGIRYSPRGIEVNDHMQTNVPHI
YACGDAAGGMQLAHAAIHEGITAAAHATGKDSKVDMRAVPRCIYTSPEMAAVGLTETQAR
ETYGDVKIGECSFSANGKALIKHQHGGKMKIIAEPEFGEIVGVSMIGPDVTELIGQAVMM
MNGEMTADMSEHFIAAHPTLSETLQEALLNVTGLAVHSV
NT seq 1380 nt   +upstreamnt  +downstreamnt
ttgacactagccattatcggcggcgggcctgccggatatgcagctgccgtgactgccgcg
cggaggggagaagaagtcgttctgatcgacaaagggccgctcggaggcacttgtctcaat
gaggggtgcatcccgacaaagtcgcttttggaaagcgcgaatgtgctcgataaaatcagg
catgcaaatacattcggcatcgaactgccgcaaaacattacactcaattgggcccgcatg
caggggcgcaaacggcaaatcgtcagccggctcgtgcagggaattcaatacttaatgaaa
gcaaatcagattaaagtcatcagcgggacagcttcatttctcacagagcagacattgctt
gttgaaggagaaggaggcgcaaaagacattctggaagcggatcggatattgattgcatcc
ggatctgaaccggcggagctgccgtttgccccatttgacggcgattgggtgatcgacagc
aaagatgcgctttctttacagaaaatcccttcttctctgcttattgtcgggggaggtgtg
atcggctgtgaatttgcctctttattcagccggtttaaaacgaaagtgactgtgattgaa
tccgctgaccggctgctcccggcagaagacggggaaatcgccgccgttttcgaagactct
ttaagagacagcggggctgatattcagacaaaagccgcccttcaacggattgataaagaa
aggaaaaccgccgtgtggacaaaagacggcaaagaaattgaggcgcaggctgatcacgtt
ttggttgcaatcgggagaaaaccgcgtttgcaagagctgaatctggagcagtccggcatc
cggtattctccgcgcggtattgaagtcaatgaccatatgcagaccaatgtgcctcatata
tacgcatgcggcgatgcggccggaggaatgcagctcgcgcatgccgccattcatgaagga
atcacagccgccgcgcatgccacgggaaaggacagcaaagtcgatatgcgggcggtgccc
cgctgtatttatacatcgccggaaatggccgctgtcgggctgacggaaacacaggcgaga
gaaacatacggagatgtgaaaatcggagaatgttcattttctgctaacggaaaagcgtta
attaaacatcagcatggcggcaaaatgaaaatcattgccgaaccggaattcggagaaatc
gtcggcgtgtcaatgatcgggccggacgtgacggaattgatcggtcaggcggtcatgatg
atgaacggtgaaatgacggcggatatgtcggagcactttatcgcggcgcatccgactctg
tcagaaacgcttcaggaagccctgctgaatgtcaccggacttgcggtgcattccgtataa

KEGG   Bacillus velezensis NAU-B3: BAPNAU_1351
Entry
BAPNAU_1351       CDS       T02859                                 

Gene name
bfmbC
Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00010  Glycolysis / Gluconeogenesis
bamb00020  Citrate cycle (TCA cycle)
bamb00260  Glycine, serine and threonine metabolism
bamb00280  Valine, leucine and isoleucine degradation
bamb00310  Lysine degradation
bamb00380  Tryptophan metabolism
bamb00620  Pyruvate metabolism
bamb00630  Glyoxylate and dicarboxylate metabolism
bamb00640  Propanoate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
bamb01240  Biosynthesis of cofactors
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bamb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAPNAU_1351 (bfmbC)
   00020 Citrate cycle (TCA cycle)
    BAPNAU_1351 (bfmbC)
   00620 Pyruvate metabolism
    BAPNAU_1351 (bfmbC)
   00630 Glyoxylate and dicarboxylate metabolism
    BAPNAU_1351 (bfmbC)
   00640 Propanoate metabolism
    BAPNAU_1351 (bfmbC)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAPNAU_1351 (bfmbC)
   00280 Valine, leucine and isoleucine degradation
    BAPNAU_1351 (bfmbC)
   00310 Lysine degradation
    BAPNAU_1351 (bfmbC)
   00380 Tryptophan metabolism
    BAPNAU_1351 (bfmbC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bamb04147]
    BAPNAU_1351 (bfmbC)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BAPNAU_1351 (bfmbC)
Exosome [BR:bamb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BAPNAU_1351 (bfmbC)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_oxidored Pyr_redox_3 FAD_binding_2 GIDA AlaDh_PNT_C DAO NAD_binding_8 FAD_binding_3 3HCDH_N K_oxygenase HI0933_like Trp_halogenase Thi4 NAD_binding_7 2-Hacid_dh_C TrkA_N
Other DBs
NCBI-ProteinID: CDH95132
LinkDB
Position
1402670..1404091
AA seq 473 aa
MATEYDVVILGGGTGGYVAAIRAAQLGLKTAVVEKEKLGGTCLHKGCIPSKALLRSAEVY
RTAKEAAGFGIETEGVSLRFDSVQKRKQGIVDRLAGGVAHLMKKGKIDVFNGYGRMLGPS
IFSPLPGTVSVEYANGEENDMLIPKQLIIATGSRPKMLPGLEADGTYILTSDEALELERL
PQSMMIVGGGVIGIEWASMLNDFGVNITVIEYADRILPTEDRDISSEMEKLLTKKGIKIV
KGAKVLPDTLEKADGVSIAAEKNGKKETYHAEQMLISIGRQPNIEGIGLENTDIEAENGS
IIVNEAGQTKESHIYAIGDVVGGLQLAHVASREGIIAVEHMAGLNPAPLDAALVPKCIYS
NPEAASVGLTEEEALRKGHELKIGKFPFMAIGKALVYGESDGFVKIVVDRNTDDILGVHM
IGPHVTDMISEAGLAKVLDATPWEIGQSIHPHPSLSEAIGEAALAADGNAIHF
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcgactgagtatgatgtggtcattctgggcggcggcacaggcggttatgtagccgcc
atcagagcggcccagctcggcttaaaaacggccgttgtagaaaaagaaaagctcggcgga
acatgcctgcataaaggatgtatcccgagtaaagcgctgttaagaagcgcggaagtgtac
cgaaccgcaaaggaagcggcaggattcggcattgaaacggaaggtgtctccctccgcttt
gacagcgtgcaaaaacgaaagcagggaatcgttgaccggctggccggcggagtcgcccac
ttgatgaaaaaggggaagattgatgtattcaacgggtacggacgtatgctcggcccttcc
atcttctcacctcttcccggtacggtttccgtcgaatacgcaaatggtgaagaaaacgac
atgctgataccgaaacaattgattatcgcaaccggttcaaggccgaaaatgctaccgggt
ttagaagcagacggtacatatattctgacatcagatgaagcgttagagcttgaacgtctg
ccccaatccatgatgatcgtcggcggcggtgtcatcggaattgaatgggcatccatgctg
aacgatttcggcgtcaatatcactgtgattgaatatgcggaccgcattttgccgacggaa
gaccgtgatatttcaagcgagatggaaaaactgttaacgaaaaaaggaattaagatcgtg
aagggtgcgaaagtgcttccggatacattggaaaaagcggacggcgtttcaattgccgct
gaaaagaatggaaaaaaagaaacgtatcacgcggaacaaatgcttatttccatcggccgc
cagccgaacattgaagggatcggccttgaaaacacggacattgaagcggaaaacggttct
atcatcgtgaacgaagccgggcagacgaaggaatcgcacatttatgcgatcggtgatgtt
gtcggcgggctgcagcttgcgcatgtggcctcccgtgagggcatcattgccgttgagcat
atggcgggtcttaatccggctccgcttgatgccgctcttgtgccgaaatgtatttattca
aatccggaagcggcgagcgtcggtctgacagaagaggaagctcttcgaaaagggcatgaa
ctgaaaatcgggaagtttccgttcatggcgatcggaaaggctcttgtatacggagaaagc
gacggctttgtcaaaatcgtcgtcgatcggaatacagatgatattctcggtgttcatatg
atcggcccgcacgtcaccgatatgatctctgaagcggggcttgccaaggtgctcgacgcg
acgccttgggaaattggccagtccatacatccgcatccgtcgctgtcagaagcgattgga
gaagctgcgttagccgcagacggaaacgcgattcatttttaa

KEGG   Bacillus velezensis NAU-B3: BAPNAU_2308
Entry
BAPNAU_2308       CDS       T02859                                 

Gene name
pdhD
Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00010  Glycolysis / Gluconeogenesis
bamb00020  Citrate cycle (TCA cycle)
bamb00260  Glycine, serine and threonine metabolism
bamb00280  Valine, leucine and isoleucine degradation
bamb00310  Lysine degradation
bamb00380  Tryptophan metabolism
bamb00620  Pyruvate metabolism
bamb00630  Glyoxylate and dicarboxylate metabolism
bamb00640  Propanoate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
bamb01240  Biosynthesis of cofactors
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bamb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAPNAU_2308 (pdhD)
   00020 Citrate cycle (TCA cycle)
    BAPNAU_2308 (pdhD)
   00620 Pyruvate metabolism
    BAPNAU_2308 (pdhD)
   00630 Glyoxylate and dicarboxylate metabolism
    BAPNAU_2308 (pdhD)
   00640 Propanoate metabolism
    BAPNAU_2308 (pdhD)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAPNAU_2308 (pdhD)
   00280 Valine, leucine and isoleucine degradation
    BAPNAU_2308 (pdhD)
   00310 Lysine degradation
    BAPNAU_2308 (pdhD)
   00380 Tryptophan metabolism
    BAPNAU_2308 (pdhD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bamb04147]
    BAPNAU_2308 (pdhD)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BAPNAU_2308 (pdhD)
Exosome [BR:bamb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BAPNAU_2308 (pdhD)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like NAD_binding_9 NAD_binding_8 DAO Amino_oxidase UDPG_MGDP_dh_N FAD_binding_3 DUF4150 Thi4 3HCDH_N AlaDh_PNT_C Trp_halogenase
Other DBs
NCBI-ProteinID: CDH96088
LinkDB
Position
complement(2481548..2482960)
AA seq 470 aa
MVVGDFPIETDTLVIGAGPGGYVAAIRAAQLGQKVTVVEKATLGGVCLNVGCIPSKALIN
AGHRYENAKHSDDMGITAENVTVDFTKVQEWKASVVNKLTGGVAGLLKGNKVDVIKGEAY
FVDSNSVRVMDENSAQTYTFKNAIIATGSRPIELPNFKYSERVLNSTGALALKEIPKKLV
VIGGGYIGTELGTAYANFGTELVILEGGDEILPGFEKQMSSLVTRRLKKKGNVEIHTSAM
AKGVEERPDGVTVTFEVKGEEKTVDADYVLITVGRRPNTDELGLEQVGIEMTDRGVIKTD
KQCRTNVPNIYAIGDIIDGPPLAHKASYEGKIAAEAISGEPAEIDYLGIPAVVFSEPELA
SVGYTEAQAKEEGIEVVAAKFPFAANGRALSLNETDGFMKLITRKEDGLVIGAQIAGASA
SDMISELSLAIEGGMTAEDIAMTIHAHPTLGEITMEAAEVAIGSPIHIVK
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggtagtaggagatttccctattgaaacagatactcttgtgattggtgcgggacctggc
ggctatgtagctgccatccgcgctgctcagcttggacaaaaagtaacagtcgttgaaaaa
gcaactcttggaggcgtttgtctgaacgtcggctgtattccttcaaaagcgctcatcaat
gcaggccatcgttacgagaatgcaaaacattcagatgacatgggaatcactgctgagaac
gtaacggttgactttacaaaagtccaagaatggaaagcttctgttgtaaataagcttacc
ggcggtgttgcaggtcttttaaaaggaaataaagtggacgttataaaaggggaagcttat
ttcgtagacagcaactctgtccgcgtaatggatgagaactctgcgcaaacatacacattt
aaaaacgcaatcattgctaccggttctcgccctatcgaattgccaaacttcaaatatagc
gaacgcgttctgaactctacaggcgcacttgcgcttaaagaaattccgaaaaagctcgtt
gttatcggcggcggatatatcggtactgagcttggaacagcgtatgcgaacttcggaact
gaattggttattttagaaggcggagatgaaattcttcctggcttcgaaaaacaaatgagt
tctctcgttacccgcagactgaagaaaaaaggcaacgttgaaatccatacaagcgctatg
gctaaaggcgttgaagaaagacctgacggcgtaacagttacattcgaagtaaaaggcgaa
gaaaaaacggttgatgctgattacgtattaatcactgtcggacgccgtccgaacactgac
gagctcggccttgagcaagtcggtatcgaaatgactgaccgcggtgtcattaaaacagac
aagcagtgccgcacaaacgtaccgaacatttacgcaatcggtgacatcattgacggacct
ccattggctcacaaagcgtcttacgaaggtaaaatcgctgcggaagctatttcaggagag
ccggctgaaatcgattacctcggtattccggcggttgtattctctgagcctgaactggct
tctgtcggttacactgaagcacaggcgaaagaagaaggcattgaagtcgttgcagctaag
ttcccgtttgcagcaaacggacgtgcgctgtctcttaacgaaactgacggcttcatgaag
ctgatcacccgtaaagaagacggtcttgtaatcggtgcgcaaattgccggcgcaagcgct
tctgacatgatttctgaattgagcctggcgatcgaaggcggaatgactgctgaagatatc
gcaatgacaattcacgctcacccgacattgggcgaaatcactatggaagctgccgaagta
gcaatcggaagcccgatccatatcgtaaaataa

DBGET integrated database retrieval system