KEGG   Bacillus velezensis NAU-B3: BAPNAU_0935
Entry
BAPNAU_0935       CDS       T02859                                 

Gene name
citZ
Definition
(GenBank) citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00020  Citrate cycle (TCA cycle)
bamb00630  Glyoxylate and dicarboxylate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
bamb01210  2-Oxocarboxylic acid metabolism
bamb01230  Biosynthesis of amino acids
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAPNAU_0935 (citZ)
   00630 Glyoxylate and dicarboxylate metabolism
    BAPNAU_0935 (citZ)
Enzymes [BR:bamb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     BAPNAU_0935 (citZ)
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: CDH94716
LinkDB
Position
1005034..1006152
AA seq 372 aa
MTATRGLEGVVATTSSVSSIIDDTLTYVGYDIDDLTENASFEEIIYLLWHLRLPNKTELA
ELKKQLAKEAAVPQEIIEHFKSYPLNNVHPMAALRTAISLLGLTDSEADVMNPEANYRKA
IRLQAKVPGIVAAFSRIRKGLDPVEPKEEYGIAENFLYTLNGEEPSPIEVEAFNKALILH
ADHELNASTFTARVCVATLSDIYSGITAAIGALKGPLHGGANEAVMKMLTEIGEVENAEP
YIRSKMEKKEKVMGFGHRVYKHGDPRAKHLKEMSKRLTNLTGESKWYEMSIRVEEIVTSE
KKLPPNVDFYSASVYHSLGIDHDLFTPIFAISRMSGWIAHILEQYDNNRLIRPRADYTGP
DKQTFVPIDERA
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgacagcaacacgcggtcttgaaggggttgtagcaacaacatcatctgtaagctctatt
atcgacgatacccttacatatgtagggtacgatattgacgacttgacagagaatgcaagt
tttgaagaaatcatttatttgctgtggcatctgcgcctgccgaataaaacggaacttgct
gaactgaaaaaacagcttgcgaaagaagctgccgttccacaagaaatcattgagcacttc
aaatcctatcccctcaataacgtacatccaatggctgcgctccggacggcgatttcatta
ctcggtctgactgacagtgaagccgatgtcatgaatccggaagcgaactacagaaaagcc
atccgtctgcaggcgaaagtgccgggcattgtcgccgctttctcaagaatccgcaaagga
cttgatcctgttgaaccgaaggaagagtatggaatcgcggagaacttcctgtacacctta
aacggtgaagagccttctccgatcgaagtggaagcgtttaacaaagcgctcattcttcat
gcggatcatgagctgaacgcatcaacatttacggcgagagtatgtgtcgccaccttatct
gatatttactcaggcatcactgccgccatcggcgctttaaaaggaccgcttcacggcgga
gccaatgaagccgtcatgaaaatgctgacagaaatcggcgaagtggaaaacgccgagcct
tatatccgcagcaaaatggagaaaaaggaaaaagtaatgggcttcggacaccgtgtgtat
aagcatggagacccgcgcgccaaacacttaaaagaaatgagcaaacgcctgacgaatctg
acgggtgaaagcaaatggtatgagatgtcaatccgtgtcgaagaaatcgtgacgtcggag
aaaaaacttccgcctaacgttgatttctattccgcatctgtataccacagtctcggcatt
gatcacgatctgttcacgccgatctttgcgatcagcagaatgtcaggatggatcgcccat
attcttgaacaatacgataacaaccgcctcatccgcccgcgcgctgattacacgggtccg
gataagcagacttttgttccgattgatgaaagagcctga

KEGG   Bacillus velezensis NAU-B3: BAPNAU_1343
Entry
BAPNAU_1343       CDS       T02859                                 

Gene name
mmgD
Definition
(GenBank) citrate synthase 3
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00020  Citrate cycle (TCA cycle)
bamb00630  Glyoxylate and dicarboxylate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
bamb01210  2-Oxocarboxylic acid metabolism
bamb01230  Biosynthesis of amino acids
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAPNAU_1343 (mmgD)
   00630 Glyoxylate and dicarboxylate metabolism
    BAPNAU_1343 (mmgD)
Enzymes [BR:bamb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     BAPNAU_1343 (mmgD)
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: CDH95124
LinkDB
Position
1393454..1394551
AA seq 365 aa
MESYSPGLDGVIAVETGISFLDTQQGSILIKGHDLIELSKTAGYMDIVHLLLEDRLPDAK
EKAALEEDVRRGGHLPEEILHICRLLPEHTHPMDGLRTGLSALGGFDKDIDDRSSSVNQH
RVRGLIGKMPNLTVNSYRVINGLEPLAPVGTLSYSANFLYMITGKTPSSLEEEIFDRSLL
LYSEHELPNSTFTARVIASTQSDIYGALTGAVASLKGNLHGGANEAVMYMLEEAKDTDGF
TQLLTQKLANKEKIMGFGHRVYMKKMDPRALMMKEALKKLSDLSGDFRLYNMCEAGETVM
REKKGLYPNLDYYAAPVYYMLGIPIPLYTPIFFSARTVGLCAHVIEQHSRNRLFRPRVRY
TGARL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggaatcttattctcccggtttagatggcgtcattgcggtggaaacggggatttctttc
ctggatacacagcagggcagtattttaatcaaaggccacgatctgattgagctttctaaa
acggccggctatatggacattgttcatctcttattggaagacagacttcctgatgcgaaa
gagaaggcggcgcttgaagaagacgttcggcgcggcggacatcttcccgaggaaatcttg
cacatatgccgtctgctgcccgaacatactcacccgatggacggactgaggacgggtttg
tccgcccttggaggctttgacaaggacatcgatgaccgttcatcttccgtaaatcagcac
cgcgtacgcggactgataggcaaaatgccgaatctgacggtcaacagctatcgagtcatc
aacgggctggagcctttggcgccggtcggaaccttatcatacagcgcaaactttttatat
atgattaccggaaaaacgccgtcatctttggaagaagaaatcttcgaccggtcgcttctt
ttatacagtgagcatgaattgccgaactcaacgtttacggcccgtgtcattgcttcgacg
caatcggatatttacggcgcgctgaccggagccgtcgcctcgcttaaaggaaaccttcac
ggcggcgcgaacgaagcggttatgtacatgcttgaagaagcgaaggatacagacgggttt
acacaattgttaactcaaaaactcgcaaacaaagaaaaaatcatgggcttcggccaccgt
gtctacatgaaaaaaatggacccgagggcgctcatgatgaaagaagcgttaaaaaagctg
tctgatctttcaggtgatttccgtctttataatatgtgtgaagccggtgaaaccgtcatg
agggagaaaaaaggcctttatccgaatttagattactacgcagcgccggtctattacatg
cttggcatcccgatcccgctgtacacgcctatattcttcagcgcacggacggtcggactg
tgcgcccacgttattgaacagcacagccgaaaccggcttttccgcccgcgtgtccgctat
accggagcgcgcctgtaa

KEGG   Bacillus velezensis NAU-B3: BAPNAU_2832
Entry
BAPNAU_2832       CDS       T02859                                 

Gene name
citA
Definition
(GenBank) citrate synthase I
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00020  Citrate cycle (TCA cycle)
bamb00630  Glyoxylate and dicarboxylate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
bamb01210  2-Oxocarboxylic acid metabolism
bamb01230  Biosynthesis of amino acids
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAPNAU_2832 (citA)
   00630 Glyoxylate and dicarboxylate metabolism
    BAPNAU_2832 (citA)
Enzymes [BR:bamb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     BAPNAU_2832 (citA)
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: CDH96612
LinkDB
Position
complement(3000520..3001629)
AA seq 369 aa
MKLIYRGLKGITCAETAISHIDGEKGHLIYRGYDAKDIALQSSFEEAAYLILNGALPDER
QLLAFQEELAAERGLPKHLIGLLETLPDEMDDMAVLRTAVSGLGTDSFTYPPKPEEAIKL
IAVTPTIIAYRYRRKQGKEALSPEARYGHVENYLYMLTGRQPSAAQKKALETYMILAMEH
GMNASTFSARVTVSTESDLVSAVTAALGTMKGPLHGGAPSGVTKMLKDIGEKENAEAYLT
AKLMRGERLMGFGHRVYKTKDPRAEALRIKAEEVAGNDPSLDLALYVEKEAIRLLEQYKP
GRKLYTNVEFYAAAVMQAIDVDNDLFTPTFSASRMAGWCAHVLEQSADNMIYRPSAKYTG
AFPETAQQL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaaattgatttatcgtggattgaaagggattacttgtgcagaaacggctatcagccac
attgacggagaaaaggggcatttaatatatcgcggctatgatgcgaaggatatcgcgctg
caatccagttttgaagaagcggcgtatctcattttgaacggggcgcttcctgatgagcgg
caattgcttgcgtttcaggaagaacttgcagccgagcgcgggcttccgaaacatttgatc
ggcttactggaaacgcttccggatgaaatggacgacatggcggtgctgagaacggctgtt
tcaggtttgggcacagattcatttacatatccgcccaagccggaagaagcgattaaactg
attgccgtcacaccgacgattattgcgtacagataccgccgtaaacaagggaaggaagcg
ttgtcacctgaggcgcgatacggacacgttgaaaactatttgtatatgctgacaggcagg
cagccgtccgcagcccaaaagaaagcgcttgagacgtatatgattctggcgatggagcac
gggatgaatgcatcgactttttcagcgagagtcaccgtttcgactgaatcggacttagtg
tctgccgtcactgccgcactgggtacgatgaaagggccgctgcacggaggcgcgccttca
ggcgtcacgaaaatgcttaaagacatcggagaaaaagaaaatgcagaagcgtatttgaca
gcgaagcttatgaggggagaacgcctgatgggcttcgggcacagggtgtacaaaacaaaa
gacccgcgggcggaggcgctgcgcataaaggctgaagaagtggcgggaaatgatccgtcg
cttgacttggcgctttatgtggagaaggaagccatccgcttgttagagcaatataagccc
ggacggaagctgtatacgaatgtggagttttacgcagcggctgtgatgcaggccattgat
gtcgacaatgatttgtttacgccgaccttttcagcaagcagaatggcaggctggtgcgca
cacgtgcttgaacagtccgctgacaacatgatttacaggccgtctgccaaatacaccggc
gcttttcccgaaacggctcagcagctttaa

DBGET integrated database retrieval system