KEGG   Bacillus velezensis NAU-B3: BAPNAU_0936
Entry
BAPNAU_0936       CDS       T02859                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00020  Citrate cycle (TCA cycle)
bamb00480  Glutathione metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
bamb01210  2-Oxocarboxylic acid metabolism
bamb01230  Biosynthesis of amino acids
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAPNAU_0936 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BAPNAU_0936 (icd)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BAPNAU_0936 (icd)
SSDB
Motif
Pfam: Iso_dh DUF5043
Other DBs
NCBI-ProteinID: CDH94717
LinkDB
Position
1006313..1007584
AA seq 423 aa
MSQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAETLEDIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVEKLISFLQNEMGVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIEYAIENGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EREYGDKVFTWAEYDRIVEKDGKEAADKAQSDAEAAGKIIVKDSIADIFLQQILTRPSEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLNWNEAADLIIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
NT seq 1272 nt   +upstreamnt  +downstreamnt
gtgtcacaaggtgaaaaaattacagtctctaatggagtattaaacgtaccaaataatccg
attatcccgtttattgaaggcgacggcacaggccctgatatttggaacgccgcttctaaa
gtattggaagccgctgttgaaaaagcatataaaggcgagaaaaaaatcacgtggaaagaa
gtttatgccggtgaaaaggcttataataaaacaggtgagtggcttcctgccgaaacgctg
gaagacatcagagagtacttcatcgccatcaaaggtcctctgacgacaccggtcggcggc
ggtatccgttctctgaacgtggcgctgagacaggagcttgatttgtttacgtgcctgcgc
cctgtcagatatttcacgggagtgccttctccggtcaaacgacctgaagatacggatatg
gtcattttccgcgagaatacggaagatatttacgccggaattgagtatgcgaaaggttct
gaagaggttgaaaagctgatcagcttcctgcaaaatgaaatgggcgttaacaaaatccgt
ttccctgaaacgtcaggaatcggcatcaagcctgtttctgaagaaggcacaagccgctta
gtcagagctgccattgagtatgcgatcgaaaacggccgtaagtctgtcacgcttgtccac
aaaggaaacatcatgaagttcactgaaggggcatttaaaaactggggctacgagcttgcc
gaaagagaatacggagataaagtattcacttgggctgaatatgaccgcattgtcgaaaaa
gacggaaaagaagcggctgataaagcgcagagcgacgcggaagcggcaggaaaaatcatc
gtcaaagacagcatcgctgatattttccttcagcagatcttgacccgtccgagcgaattc
gacgtcgtggcgactatgaacttaaacggagactatatctctgatgcgcttgccgctcag
gtaggcggaatcggaatcgcgccgggagcgaacatcaactatgaaacaggccatgcgatt
ttcgaagcgactcacggaacggctcctaaatatgccggccttgacaaagtcaacccgtca
tccgtcatcctttcaggagtgcttcttcttgaacacctgaactggaatgaggctgctgac
ttgatcattaaatctatggaaaaaacgattgcttcaaaagtagtaacgtacgattttgct
agattaatggacggtgcaactgaagtgaaatgttcagagtttggtgaagagctaatcaaa
aacatggactga

DBGET integrated database retrieval system