KEGG   Bacillus velezensis NAU-B3: BAPNAU_0937
Entry
BAPNAU_0937       CDS       T02859                                 

Gene name
mdh
Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00020  Citrate cycle (TCA cycle)
bamb00270  Cysteine and methionine metabolism
bamb00620  Pyruvate metabolism
bamb00630  Glyoxylate and dicarboxylate metabolism
bamb00680  Methane metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01200  Carbon metabolism
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAPNAU_0937 (mdh)
   00620 Pyruvate metabolism
    BAPNAU_0937 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    BAPNAU_0937 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    BAPNAU_0937 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BAPNAU_0937 (mdh)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     BAPNAU_0937 (mdh)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C UDPG_MGDP_dh_N Glyco_hydro_4 DAO 3HCDH_N NAD_binding_8 AlaDh_PNT_C Pyr_redox_2
Other DBs
NCBI-ProteinID: CDH94718
LinkDB
Position
1007630..1008568
AA seq 312 aa
MGKTRSKVSVIGAGFTGATTAFLTAQKELADVVLVDIPQLENPTKGKALDMLEASPVQGF
DAKITGTSNYEDTAGSDIVVITAGIARKPGMSRDDLVSTNEKIMRSVTREIVKYSPDCII
VVLTNPVDAMTYAVYKESGFPKERVIGQSGVLDTARFRTFVAEELNLSVKDVTGFVLGGH
GDDMVPLVRYSYAGGIPLETLIPKDRLDAIVERTRKGGGEIVNLLGNGSAYYAPAASLTE
MVEAILKDQRRVLPTIAYLEGEYGHEGIYLGVPTIIGGNGLEQIIELELTDYEKAQLSKS
VESVKNVMKVLS
NT seq 939 nt   +upstreamnt  +downstreamnt
atgggaaaaacacgcagtaaagtttctgttatcggagcaggatttacgggagcgacaaca
gcctttcttacagctcaaaaagagcttgcagacgttgtgctcgttgatattccgcaatta
gaaaacccgacaaaaggaaaagcgctagacatgctcgaagcaagtccggttcaaggattt
gacgcgaaaatcacaggcacgtccaactacgaggacacagccggttctgatatcgtcgtc
atcacagccggaattgcgagaaaaccgggcatgagccgtgatgatcttgtatctacaaac
gaaaaaatcatgagaagcgtcacacgtgagatcgtgaaatattctcctgactgcattatc
gttgtattgacaaaccctgttgatgcgatgacatatgcggtgtacaaagaatcaggcttc
ccgaaagaacgcgtcatcggacaatccggagtgcttgacactgcgcgattcagaacattc
gtcgctgaagaattaaacctgtctgtaaaagatgtgaccggttttgttcttggcggacac
ggtgacgacatggttcctctcgtccgttattcctatgcgggcggcattccgcttgaaacg
cttatcccgaaagaccgtcttgatgcgattgtagaacgcacaagaaaaggcggcggggaa
atcgtcaaccttctcggcaacggaagcgcctactacgcgcctgctgcatcactgactgaa
atggtagaagccattttgaaagatcagcgccgcgtgcttccgactatcgcttacttagaa
ggcgaatacggtcatgaaggtatttacttaggcgtaccgacgattatcggaggaaacggc
ctagagcaaatcatcgagcttgaactgacagactatgaaaaagcgcagctgagtaaatca
gttgaatctgtcaaaaacgtgatgaaagtattgtcataa

DBGET integrated database retrieval system