KEGG   Bacillus velezensis NAU-B3: BAPNAU_1002Help
Entry
BAPNAU_1002       CDS       T02859                                 

Gene name
sdhA1
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00020  Citrate cycle (TCA cycle)
bamb00190  Oxidative phosphorylation
bamb00650  Butanoate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01130  Biosynthesis of antibiotics
bamb01200  Carbon metabolism
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAPNAU_1002 (sdhA1)
   00650 Butanoate metabolism
    BAPNAU_1002 (sdhA1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BAPNAU_1002 (sdhA1)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BAPNAU_1002 (sdhA1)
    1.3.5.4  fumarate reductase (quinol)
     BAPNAU_1002 (sdhA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored Not3 DUF844 DAO AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: CDH94783
LinkDB All DBs
Position
1078468..1080228
Genome map
AA seq 586 aa AA seqDB search
MSQSSIIVVGGGLAGLMATIKAAESGTAVKLFSIVPVKRSHSVCAQGGINGAVNTKGEGD
SPFEHFDDTVYGGDFLANQPPVKAMCEAAPSIIHLLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAYAGATTGQQLLYALDEQVRRYEVAGLVTKYEGWEFLGAVLDDERTCRGIVAQNLT
NMQIESFRSDAVIMATGGPGIVFGKSTNSMINTGSAASIVYQQGAYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPKELDVKLGGIIEIYEKFMGDDPRKLPMKIFPAVHYSMGGLWV
DYDQMTSIRGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAVKYVSGLETSAEDL
SSSLFDSYVKKEEEKWADIMKMDGDENAYVLHRELGEWMTANVTVVRHNDKLLKTDDKIQ
ELMERFKKININDTTKWSNQGAMFTRQFSNMLQLARVITLGAYNRNESRGAHYKPDFPER
NDDEWLKTTMAKHAGPFEAPEFEYQDVDVSLIAPRKRDYSKKKVAK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcaagcattatcgtagtcggcgggggtcttgccggcctcatggcgacaatt
aaagcagcggaatcaggtacggccgttaaattgttttccatcgttccggtcaaacgctct
cactcggtctgcgcgcagggcgggataaacggagctgtcaacacaaaaggggaaggagac
tctccgtttgagcattttgatgacacggtatacggaggcgactttttggcaaaccagcct
cctgtaaaagcgatgtgtgaagcggcgccgtccattatccacttattggaccgcatgggg
gttatgtttaacagaacgccggaagggctcttggacttccgccgtttcgggggtacacag
catcacagaaccgcatacgcgggagcgacgacgggtcagcagcttctttacgcactggac
gagcaggtgcgcagatatgaagtggcgggtctcgtcacaaaatatgaaggctgggaattc
ctcggcgccgttcttgacgatgagcgcacgtgccgcggtatcgtagcccaaaatctgacc
aatatgcaaatcgagtcattccgttctgacgccgttattatggcgacgggaggtcccgga
atcgtattcggcaaatcaacaaacagcatgatcaacacggggtctgccgcatcaatcgtt
tatcagcagggcgcttattatgcaaacggcgaatttatccaaattcacccgacagcaatc
ccgggggacgataaactgcgtctgatgagtgaatcggcgcgcggcgagggcggaagagtc
tggacgtataaagacggaaaaccttggtacttccttgaggaaaaatatccggcttacgga
aacctcgtgccgcgggatattgcgacacgtgaaatctttgacgtgtgcgtgaatcagaaa
ctcggcatcaacggagaaaacatggtgtatctcgatctgtcgcacaaagatccgaaagag
cttgacgttaagcttggcggcattatcgaaatctatgaaaaattcatgggcgatgacccg
cgcaagcttccgatgaaaattttccctgccgttcactattcaatgggcggactgtgggtt
gattatgatcagatgacaagcatccgcggactgttcgcagcgggtgaatgtgattattca
atgcacggaggaaaccgtttaggcgcgaactctctgctttccgccatctacggaggaatg
gtggccggaccgaatgcggtgaaatatgtttccggacttgaaacatcagcagaagacctg
tcttcttcattatttgattcctatgtgaaaaaagaagaagaaaaatgggccgatattatg
aagatggacggcgacgaaaatgcttacgtgcttcaccgtgagctcggagaatggatgacg
gccaacgtcacggtggtccgccacaacgacaagcttttgaaaacggatgacaaaatccaa
gagctgatggaacgctttaagaaaatcaatatcaacgatacgacaaaatggagcaaccaa
ggggcgatgttcacccgccagttctccaatatgcttcagcttgccagagtcatcacgctc
ggcgcatataaccgaaatgaaagccggggagcgcactataaaccggatttccctgaaaga
aatgacgatgagtggctcaaaacgacgatggcgaaacatgccggtccgtttgaagctccg
gaatttgaatatcaggatgtcgatgtatcactgattgcgccccgtaaacgcgactactcg
aagaagaaggtggcgaaataa

DBGET integrated database retrieval system