KEGG   Bacillus velezensis NAU-B3: BAPNAU_1003Help
Entry
BAPNAU_1003       CDS       T02859                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bamb  Bacillus velezensis NAU-B3
Pathway
bamb00020  Citrate cycle (TCA cycle)
bamb00190  Oxidative phosphorylation
bamb00650  Butanoate metabolism
bamb01100  Metabolic pathways
bamb01110  Biosynthesis of secondary metabolites
bamb01120  Microbial metabolism in diverse environments
bamb01130  Biosynthesis of antibiotics
bamb01200  Carbon metabolism
Module
bamb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bamb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bamb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAPNAU_1003 (sdhB)
   00650 Butanoate metabolism
    BAPNAU_1003 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BAPNAU_1003 (sdhB)
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BAPNAU_1003 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BAPNAU_1003 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_18 Fer4_2 Fer4 Fer4_16 Fer4_15 Fer4_4 Fer4_13 Fer4_21 Fer4_3
Motif
Other DBs
NCBI-ProteinID: CDH94784
LinkDB All DBs
Position
1080231..1080989
Genome map
AA seq 252 aa AA seqDB search
MSEKKIRFIITRQDTPESAPYDEEFEINYRPNLNVISALMEIRRNPVNAKGEKTTPVAWD
MNCLEEVCGACSMVINGRPRQSCTALIDKLEQPIRLKPMKTFPVVRDLQVDRSRMFDSLK
KVKAWVPIDGTYDLGPGPRMPEKRRQWAYELSKCMTCGVCLEACPNVNSKSKFMGPAPMS
QVRLFNAHPTGAMNKAERLEALMTDGGLGDCGNSQNCVQSCPKGIPLTTSIAALNRDTNL
QAFRNFFGSDRV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaaaaagatacggtttatcattacacgtcaggatacgcccgaaagcgcgcca
tacgatgaagaattcgaaatcaattaccgcccgaatctgaacgtgatttctgccctgatg
gaaatccgcagaaatcctgtgaatgcaaaaggagagaaaaccactccggtcgcatgggac
atgaactgtcttgaagaagtatgcggcgcctgctccatggtcatcaacgggagaccgcgc
cagtcatgtacggcgctgattgataagctggaacagccgatccgtctgaagccgatgaaa
acattcccggttgtccgtgaccttcaggttgaccgcagcagaatgtttgattcactgaaa
aaagtgaaagcatgggtgccgattgacggaacttatgatttggggccggggccgagaatg
ccggaaaaacgccgccagtgggcatatgaattgtctaaatgcatgacatgcggcgtctgc
ctcgaagcctgcccgaacgtcaacagcaagtcgaaattcatggggcctgccccgatgtcg
caagtgcgtctgtttaacgcccatccgacgggcgcgatgaacaaagcagaacgtttagaa
gcgttaatgacagacggcggcctcggagattgcgggaattcacaaaactgtgtgcaatcc
tgcccgaaaggcattccgcttacgacttcaatcgccgctttgaacagagataccaattta
caagcattccgtaatttcttcggaagcgacagagtataa

DBGET integrated database retrieval system