KEGG   Bacillus velezensis NAU-B3: BAPNAU_1249Help
Entry
BAPNAU_1249       CDS       T02859                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, Fe-Mn family
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bamb  Bacillus velezensis NAU-B3
Brite
Enzymes [BR:bamb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BAPNAU_1249 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CDH95030
LinkDB All DBs
Position
1319204..1319809
Genome map
AA seq 201 aa AA seqDB search
MAYKLPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAIEGSALAEKSVDELVADL
NAVPEDIRTAVRNNGGGHANHSLFWTLLSPNGGGEPTGELAEEIKSTFGSFDQFKEKFAA
AAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPVLGLDVWEHAYYLNYQNRRPDY
ISAFWNVVNWDEVARLYSEAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttacaaacttccagaattgccttacgcttatgatgctttagaacctcatatcgat
aaggaaacgatgacgattcaccatacgaagcaccataacacatacgtgacaaacctcaac
aaagcgatcgaaggatcagcgcttgcagagaaatctgtagatgagcttgttgctgatttg
aacgcagtgccggaggacatccgcacggcagtccgcaacaatggcggcggacatgcaaac
cactctttattctggactcttttatctccgaacggcggaggcgaaccgactggtgagctt
gctgaagagatcaaaagcacgttcggaagcttcgatcaatttaaagaaaaattcgccgca
gcagctgcaggccgtttcggttcaggctgggcttggctcgttgtaaataacggcaaactt
gaaattacaagcacgccaaatcaagattcaccgctttcagagggtaaaacacctgttctc
ggtcttgatgtttgggagcacgcgtactacctgaactaccaaaaccgccgtcctgattac
atttcagctttctggaatgttgtgaactgggatgaagttgcccgtctttacagcgaagca
aaataa

DBGET integrated database retrieval system